Elaboration of the plasma-dielectric wakefield accelerator with a profiled sequence of driver electron bunches
A theoretical and experimental study of wakefield excitation by a profiled sequence of relativistic electron bunches in the plasma-dielectric structure, the parameters of which provide the conditions for the excitation of a small decelerating field for all driver bunches with simultaneous growth wit...
Saved in:
| Published in: | Problems of Atomic Science and Technology |
|---|---|
| Date: | 2023 |
| Main Authors: | , , , , , , , , , , |
| Format: | Article |
| Language: | English |
| Published: |
Національний науковий центр «Харківський фізико-технічний інститут» НАН України
2023
|
| Subjects: | |
| Online Access: | https://nasplib.isofts.kiev.ua/handle/123456789/196174 |
| Tags: |
Add Tag
No Tags, Be the first to tag this record!
|
| Journal Title: | Digital Library of Periodicals of National Academy of Sciences of Ukraine |
| Cite this: | Elaboration of the plasma-dielectric wakefield accelerator with a profiled sequence of driver electron bunches / I.N. Onishchenko, K.V. Galaydych, R.R. Kniaziev, G.O. Krivonosov, A.F. Linnik, P.I. Markov, O.L. Omelayenko, V.I. Pristupa, G.V. Sotnikov, V.S. Us, D.Yu. Zaleskiy // Problems of Atomic Science and Technology. — 2023. — № 4. — С. 53-60. — Бібліогр.: 14 назв. — англ. |
Institution
Digital Library of Periodicals of National Academy of Sciences of Ukraine| id |
nasplib_isofts_kiev_ua-123456789-196174 |
|---|---|
| record_format |
dspace |
| spelling |
Onishchenko, I.N. Galaydych, K.V. Kniaziev, R.R. Krivonosov, G.O. Linnik, A.F. Markov, P.I. Omelayenko, O.L. Pristupa, V.I. Sotnikov, G.V. Us, V.S. Zaleskiy, D.Yu. 2023-12-11T11:51:09Z 2023-12-11T11:51:09Z 2023 Elaboration of the plasma-dielectric wakefield accelerator with a profiled sequence of driver electron bunches / I.N. Onishchenko, K.V. Galaydych, R.R. Kniaziev, G.O. Krivonosov, A.F. Linnik, P.I. Markov, O.L. Omelayenko, V.I. Pristupa, G.V. Sotnikov, V.S. Us, D.Yu. Zaleskiy // Problems of Atomic Science and Technology. — 2023. — № 4. — С. 53-60. — Бібліогр.: 14 назв. — англ. 1562-6016 PACS: 41.75.Ht; 41.75.Lx DOI: https://doi.org/10.46813/2023-146-053 https://nasplib.isofts.kiev.ua/handle/123456789/196174 A theoretical and experimental study of wakefield excitation by a profiled sequence of relativistic electron bunches in the plasma-dielectric structure, the parameters of which provide the conditions for the excitation of a small decelerating field for all driver bunches with simultaneous growth with the number of bunches of the accelerating total wakefield was carried out. Theoretically, the transformation ratio was found for the parameters of the experiment as the ratio of the total wakefield of the sequence to the field that decelerates driver bunches. In the performed experiments, the total wakefield was measured by the microwave probe. The magnitude of the decelerating field is determined by the shift of the maximum of the spectrum measured by the magnetic analyzer before and after wakefield excitation in the structure. The obtained transformation ratio increases with the number of bunches in the sequence and significantly exceeds this one for a nonprofiled sequence. Виконано теоретичне та експериментальне дослідження збудження кільватерного поля профільованою послідовністю релятивістських електронних згустків у плазмово-діелектричній структурі, параметри якої забезпечують умови для збудження малого сповільнюючого поля для всіх драйверних згустків з одночасним зростанням з кількістю згустків прискорювального сумарного кільватерного поля. У теорії для параметрів експерименту знайдено коефіцієнт трансформації як відношення повного кільватерного поля послідовності до поля, що сповільнює драйверні згустки. В експерименті сумарне кільватерне поле вимірювалося мікрохвильовим зондом. Величина сповільнюючого поля знаходилась по зсуву максимуму енергетичного спектра, вимірюваного магнітним аналізатором до та після збудження кільватерного поля у структурі. Отриманий коефіцієнт трансформації зростає зі збільшенням кількості згустків у послідовності та значно перевищує такий для непрофільованої послідовності. This work was supported by NAS of Ukraine Program “Plasma physics and plasma electronics: basic researches and applications”, Project П4/60-2022. en Національний науковий центр «Харківський фізико-технічний інститут» НАН України Problems of Atomic Science and Technology New methods of charged particles acceleration Elaboration of the plasma-dielectric wakefield accelerator with a profiled sequence of driver electron bunches Розробка плазмово-діелектричного кільватерного прискорювача з профільованою послідовністю драйверних електронних згустків Article published earlier |
| institution |
Digital Library of Periodicals of National Academy of Sciences of Ukraine |
| collection |
DSpace DC |
| title |
Elaboration of the plasma-dielectric wakefield accelerator with a profiled sequence of driver electron bunches |
| spellingShingle |
Elaboration of the plasma-dielectric wakefield accelerator with a profiled sequence of driver electron bunches Onishchenko, I.N. Galaydych, K.V. Kniaziev, R.R. Krivonosov, G.O. Linnik, A.F. Markov, P.I. Omelayenko, O.L. Pristupa, V.I. Sotnikov, G.V. Us, V.S. Zaleskiy, D.Yu. New methods of charged particles acceleration |
| title_short |
Elaboration of the plasma-dielectric wakefield accelerator with a profiled sequence of driver electron bunches |
| title_full |
Elaboration of the plasma-dielectric wakefield accelerator with a profiled sequence of driver electron bunches |
| title_fullStr |
Elaboration of the plasma-dielectric wakefield accelerator with a profiled sequence of driver electron bunches |
| title_full_unstemmed |
Elaboration of the plasma-dielectric wakefield accelerator with a profiled sequence of driver electron bunches |
| title_sort |
elaboration of the plasma-dielectric wakefield accelerator with a profiled sequence of driver electron bunches |
| author |
Onishchenko, I.N. Galaydych, K.V. Kniaziev, R.R. Krivonosov, G.O. Linnik, A.F. Markov, P.I. Omelayenko, O.L. Pristupa, V.I. Sotnikov, G.V. Us, V.S. Zaleskiy, D.Yu. |
| author_facet |
Onishchenko, I.N. Galaydych, K.V. Kniaziev, R.R. Krivonosov, G.O. Linnik, A.F. Markov, P.I. Omelayenko, O.L. Pristupa, V.I. Sotnikov, G.V. Us, V.S. Zaleskiy, D.Yu. |
| topic |
New methods of charged particles acceleration |
| topic_facet |
New methods of charged particles acceleration |
| publishDate |
2023 |
| language |
English |
| container_title |
Problems of Atomic Science and Technology |
| publisher |
Національний науковий центр «Харківський фізико-технічний інститут» НАН України |
| format |
Article |
| title_alt |
Розробка плазмово-діелектричного кільватерного прискорювача з профільованою послідовністю драйверних електронних згустків |
| description |
A theoretical and experimental study of wakefield excitation by a profiled sequence of relativistic electron bunches in the plasma-dielectric structure, the parameters of which provide the conditions for the excitation of a small decelerating field for all driver bunches with simultaneous growth with the number of bunches of the accelerating total wakefield was carried out. Theoretically, the transformation ratio was found for the parameters of the experiment as the ratio of the total wakefield of the sequence to the field that decelerates driver bunches. In the performed experiments, the total wakefield was measured by the microwave probe. The magnitude of the decelerating field is determined by the shift of the maximum of the spectrum measured by the magnetic analyzer before and after wakefield excitation in the structure. The obtained transformation ratio increases with the number of bunches in the sequence and significantly exceeds this one for a nonprofiled sequence.
Виконано теоретичне та експериментальне дослідження збудження кільватерного поля профільованою послідовністю релятивістських електронних згустків у плазмово-діелектричній структурі, параметри якої забезпечують умови для збудження малого сповільнюючого поля для всіх драйверних згустків з одночасним зростанням з кількістю згустків прискорювального сумарного кільватерного поля. У теорії для параметрів експерименту знайдено коефіцієнт трансформації як відношення повного кільватерного поля послідовності до поля, що сповільнює драйверні згустки. В експерименті сумарне кільватерне поле вимірювалося мікрохвильовим зондом. Величина сповільнюючого поля знаходилась по зсуву максимуму енергетичного спектра, вимірюваного магнітним аналізатором до та після збудження кільватерного поля у структурі. Отриманий коефіцієнт трансформації зростає зі збільшенням кількості згустків у послідовності та значно перевищує такий для непрофільованої послідовності.
|
| issn |
1562-6016 |
| url |
https://nasplib.isofts.kiev.ua/handle/123456789/196174 |
| citation_txt |
Elaboration of the plasma-dielectric wakefield accelerator with a profiled sequence of driver electron bunches / I.N. Onishchenko, K.V. Galaydych, R.R. Kniaziev, G.O. Krivonosov, A.F. Linnik, P.I. Markov, O.L. Omelayenko, V.I. Pristupa, G.V. Sotnikov, V.S. Us, D.Yu. Zaleskiy // Problems of Atomic Science and Technology. — 2023. — № 4. — С. 53-60. — Бібліогр.: 14 назв. — англ. |
| work_keys_str_mv |
AT onishchenkoin elaborationoftheplasmadielectricwakefieldacceleratorwithaprofiledsequenceofdriverelectronbunches AT galaydychkv elaborationoftheplasmadielectricwakefieldacceleratorwithaprofiledsequenceofdriverelectronbunches AT kniazievrr elaborationoftheplasmadielectricwakefieldacceleratorwithaprofiledsequenceofdriverelectronbunches AT krivonosovgo elaborationoftheplasmadielectricwakefieldacceleratorwithaprofiledsequenceofdriverelectronbunches AT linnikaf elaborationoftheplasmadielectricwakefieldacceleratorwithaprofiledsequenceofdriverelectronbunches AT markovpi elaborationoftheplasmadielectricwakefieldacceleratorwithaprofiledsequenceofdriverelectronbunches AT omelayenkool elaborationoftheplasmadielectricwakefieldacceleratorwithaprofiledsequenceofdriverelectronbunches AT pristupavi elaborationoftheplasmadielectricwakefieldacceleratorwithaprofiledsequenceofdriverelectronbunches AT sotnikovgv elaborationoftheplasmadielectricwakefieldacceleratorwithaprofiledsequenceofdriverelectronbunches AT usvs elaborationoftheplasmadielectricwakefieldacceleratorwithaprofiledsequenceofdriverelectronbunches AT zaleskiydyu elaborationoftheplasmadielectricwakefieldacceleratorwithaprofiledsequenceofdriverelectronbunches AT onishchenkoin rozrobkaplazmovodíelektričnogokílʹvaternogopriskorûvačazprofílʹovanoûposlídovnístûdraivernihelektronnihzgustkív AT galaydychkv rozrobkaplazmovodíelektričnogokílʹvaternogopriskorûvačazprofílʹovanoûposlídovnístûdraivernihelektronnihzgustkív AT kniazievrr rozrobkaplazmovodíelektričnogokílʹvaternogopriskorûvačazprofílʹovanoûposlídovnístûdraivernihelektronnihzgustkív AT krivonosovgo rozrobkaplazmovodíelektričnogokílʹvaternogopriskorûvačazprofílʹovanoûposlídovnístûdraivernihelektronnihzgustkív AT linnikaf rozrobkaplazmovodíelektričnogokílʹvaternogopriskorûvačazprofílʹovanoûposlídovnístûdraivernihelektronnihzgustkív AT markovpi rozrobkaplazmovodíelektričnogokílʹvaternogopriskorûvačazprofílʹovanoûposlídovnístûdraivernihelektronnihzgustkív AT omelayenkool rozrobkaplazmovodíelektričnogokílʹvaternogopriskorûvačazprofílʹovanoûposlídovnístûdraivernihelektronnihzgustkív AT pristupavi rozrobkaplazmovodíelektričnogokílʹvaternogopriskorûvačazprofílʹovanoûposlídovnístûdraivernihelektronnihzgustkív AT sotnikovgv rozrobkaplazmovodíelektričnogokílʹvaternogopriskorûvačazprofílʹovanoûposlídovnístûdraivernihelektronnihzgustkív AT usvs rozrobkaplazmovodíelektričnogokílʹvaternogopriskorûvačazprofílʹovanoûposlídovnístûdraivernihelektronnihzgustkív AT zaleskiydyu rozrobkaplazmovodíelektričnogokílʹvaternogopriskorûvačazprofílʹovanoûposlídovnístûdraivernihelektronnihzgustkív |
| first_indexed |
2025-12-07T15:58:06Z |
| last_indexed |
2025-12-07T15:58:06Z |
| _version_ |
1850865705864396800 |