Elaboration of the plasma-dielectric wakefield accelerator with a profiled sequence of driver electron bunches

A theoretical and experimental study of wakefield excitation by a profiled sequence of relativistic electron bunches in the plasma-dielectric structure, the parameters of which provide the conditions for the excitation of a small decelerating field for all driver bunches with simultaneous growth wit...

Full description

Saved in:
Bibliographic Details
Published in:Problems of Atomic Science and Technology
Date:2023
Main Authors: Onishchenko, I.N., Galaydych, K.V., Kniaziev, R.R., Krivonosov, G.O., Linnik, A.F., Markov, P.I., Omelayenko, O.L., Pristupa, V.I., Sotnikov, G.V., Us, V.S., Zaleskiy, D.Yu.
Format: Article
Language:English
Published: Національний науковий центр «Харківський фізико-технічний інститут» НАН України 2023
Subjects:
Online Access:https://nasplib.isofts.kiev.ua/handle/123456789/196174
Tags: Add Tag
No Tags, Be the first to tag this record!
Journal Title:Digital Library of Periodicals of National Academy of Sciences of Ukraine
Cite this:Elaboration of the plasma-dielectric wakefield accelerator with a profiled sequence of driver electron bunches / I.N. Onishchenko, K.V. Galaydych, R.R. Kniaziev, G.O. Krivonosov, A.F. Linnik, P.I. Markov, O.L. Omelayenko, V.I. Pristupa, G.V. Sotnikov, V.S. Us, D.Yu. Zaleskiy // Problems of Atomic Science and Technology. — 2023. — № 4. — С. 53-60. — Бібліогр.: 14 назв. — англ.

Institution

Digital Library of Periodicals of National Academy of Sciences of Ukraine
id nasplib_isofts_kiev_ua-123456789-196174
record_format dspace
spelling Onishchenko, I.N.
Galaydych, K.V.
Kniaziev, R.R.
Krivonosov, G.O.
Linnik, A.F.
Markov, P.I.
Omelayenko, O.L.
Pristupa, V.I.
Sotnikov, G.V.
Us, V.S.
Zaleskiy, D.Yu.
2023-12-11T11:51:09Z
2023-12-11T11:51:09Z
2023
Elaboration of the plasma-dielectric wakefield accelerator with a profiled sequence of driver electron bunches / I.N. Onishchenko, K.V. Galaydych, R.R. Kniaziev, G.O. Krivonosov, A.F. Linnik, P.I. Markov, O.L. Omelayenko, V.I. Pristupa, G.V. Sotnikov, V.S. Us, D.Yu. Zaleskiy // Problems of Atomic Science and Technology. — 2023. — № 4. — С. 53-60. — Бібліогр.: 14 назв. — англ.
1562-6016
PACS: 41.75.Ht; 41.75.Lx
DOI: https://doi.org/10.46813/2023-146-053
https://nasplib.isofts.kiev.ua/handle/123456789/196174
A theoretical and experimental study of wakefield excitation by a profiled sequence of relativistic electron bunches in the plasma-dielectric structure, the parameters of which provide the conditions for the excitation of a small decelerating field for all driver bunches with simultaneous growth with the number of bunches of the accelerating total wakefield was carried out. Theoretically, the transformation ratio was found for the parameters of the experiment as the ratio of the total wakefield of the sequence to the field that decelerates driver bunches. In the performed experiments, the total wakefield was measured by the microwave probe. The magnitude of the decelerating field is determined by the shift of the maximum of the spectrum measured by the magnetic analyzer before and after wakefield excitation in the structure. The obtained transformation ratio increases with the number of bunches in the sequence and significantly exceeds this one for a nonprofiled sequence.
Виконано теоретичне та експериментальне дослідження збудження кільватерного поля профільованою послідовністю релятивістських електронних згустків у плазмово-діелектричній структурі, параметри якої забезпечують умови для збудження малого сповільнюючого поля для всіх драйверних згустків з одночасним зростанням з кількістю згустків прискорювального сумарного кільватерного поля. У теорії для параметрів експерименту знайдено коефіцієнт трансформації як відношення повного кільватерного поля послідовності до поля, що сповільнює драйверні згустки. В експерименті сумарне кільватерне поле вимірювалося мікрохвильовим зондом. Величина сповільнюючого поля знаходилась по зсуву максимуму енергетичного спектра, вимірюваного магнітним аналізатором до та після збудження кільватерного поля у структурі. Отриманий коефіцієнт трансформації зростає зі збільшенням кількості згустків у послідовності та значно перевищує такий для непрофільованої послідовності.
This work was supported by NAS of Ukraine Program “Plasma physics and plasma electronics: basic researches and applications”, Project П4/60-2022.
en
Національний науковий центр «Харківський фізико-технічний інститут» НАН України
Problems of Atomic Science and Technology
New methods of charged particles acceleration
Elaboration of the plasma-dielectric wakefield accelerator with a profiled sequence of driver electron bunches
Розробка плазмово-діелектричного кільватерного прискорювача з профільованою послідовністю драйверних електронних згустків
Article
published earlier
institution Digital Library of Periodicals of National Academy of Sciences of Ukraine
collection DSpace DC
title Elaboration of the plasma-dielectric wakefield accelerator with a profiled sequence of driver electron bunches
spellingShingle Elaboration of the plasma-dielectric wakefield accelerator with a profiled sequence of driver electron bunches
Onishchenko, I.N.
Galaydych, K.V.
Kniaziev, R.R.
Krivonosov, G.O.
Linnik, A.F.
Markov, P.I.
Omelayenko, O.L.
Pristupa, V.I.
Sotnikov, G.V.
Us, V.S.
Zaleskiy, D.Yu.
New methods of charged particles acceleration
title_short Elaboration of the plasma-dielectric wakefield accelerator with a profiled sequence of driver electron bunches
title_full Elaboration of the plasma-dielectric wakefield accelerator with a profiled sequence of driver electron bunches
title_fullStr Elaboration of the plasma-dielectric wakefield accelerator with a profiled sequence of driver electron bunches
title_full_unstemmed Elaboration of the plasma-dielectric wakefield accelerator with a profiled sequence of driver electron bunches
title_sort elaboration of the plasma-dielectric wakefield accelerator with a profiled sequence of driver electron bunches
author Onishchenko, I.N.
Galaydych, K.V.
Kniaziev, R.R.
Krivonosov, G.O.
Linnik, A.F.
Markov, P.I.
Omelayenko, O.L.
Pristupa, V.I.
Sotnikov, G.V.
Us, V.S.
Zaleskiy, D.Yu.
author_facet Onishchenko, I.N.
Galaydych, K.V.
Kniaziev, R.R.
Krivonosov, G.O.
Linnik, A.F.
Markov, P.I.
Omelayenko, O.L.
Pristupa, V.I.
Sotnikov, G.V.
Us, V.S.
Zaleskiy, D.Yu.
topic New methods of charged particles acceleration
topic_facet New methods of charged particles acceleration
publishDate 2023
language English
container_title Problems of Atomic Science and Technology
publisher Національний науковий центр «Харківський фізико-технічний інститут» НАН України
format Article
title_alt Розробка плазмово-діелектричного кільватерного прискорювача з профільованою послідовністю драйверних електронних згустків
description A theoretical and experimental study of wakefield excitation by a profiled sequence of relativistic electron bunches in the plasma-dielectric structure, the parameters of which provide the conditions for the excitation of a small decelerating field for all driver bunches with simultaneous growth with the number of bunches of the accelerating total wakefield was carried out. Theoretically, the transformation ratio was found for the parameters of the experiment as the ratio of the total wakefield of the sequence to the field that decelerates driver bunches. In the performed experiments, the total wakefield was measured by the microwave probe. The magnitude of the decelerating field is determined by the shift of the maximum of the spectrum measured by the magnetic analyzer before and after wakefield excitation in the structure. The obtained transformation ratio increases with the number of bunches in the sequence and significantly exceeds this one for a nonprofiled sequence. Виконано теоретичне та експериментальне дослідження збудження кільватерного поля профільованою послідовністю релятивістських електронних згустків у плазмово-діелектричній структурі, параметри якої забезпечують умови для збудження малого сповільнюючого поля для всіх драйверних згустків з одночасним зростанням з кількістю згустків прискорювального сумарного кільватерного поля. У теорії для параметрів експерименту знайдено коефіцієнт трансформації як відношення повного кільватерного поля послідовності до поля, що сповільнює драйверні згустки. В експерименті сумарне кільватерне поле вимірювалося мікрохвильовим зондом. Величина сповільнюючого поля знаходилась по зсуву максимуму енергетичного спектра, вимірюваного магнітним аналізатором до та після збудження кільватерного поля у структурі. Отриманий коефіцієнт трансформації зростає зі збільшенням кількості згустків у послідовності та значно перевищує такий для непрофільованої послідовності.
issn 1562-6016
url https://nasplib.isofts.kiev.ua/handle/123456789/196174
citation_txt Elaboration of the plasma-dielectric wakefield accelerator with a profiled sequence of driver electron bunches / I.N. Onishchenko, K.V. Galaydych, R.R. Kniaziev, G.O. Krivonosov, A.F. Linnik, P.I. Markov, O.L. Omelayenko, V.I. Pristupa, G.V. Sotnikov, V.S. Us, D.Yu. Zaleskiy // Problems of Atomic Science and Technology. — 2023. — № 4. — С. 53-60. — Бібліогр.: 14 назв. — англ.
work_keys_str_mv AT onishchenkoin elaborationoftheplasmadielectricwakefieldacceleratorwithaprofiledsequenceofdriverelectronbunches
AT galaydychkv elaborationoftheplasmadielectricwakefieldacceleratorwithaprofiledsequenceofdriverelectronbunches
AT kniazievrr elaborationoftheplasmadielectricwakefieldacceleratorwithaprofiledsequenceofdriverelectronbunches
AT krivonosovgo elaborationoftheplasmadielectricwakefieldacceleratorwithaprofiledsequenceofdriverelectronbunches
AT linnikaf elaborationoftheplasmadielectricwakefieldacceleratorwithaprofiledsequenceofdriverelectronbunches
AT markovpi elaborationoftheplasmadielectricwakefieldacceleratorwithaprofiledsequenceofdriverelectronbunches
AT omelayenkool elaborationoftheplasmadielectricwakefieldacceleratorwithaprofiledsequenceofdriverelectronbunches
AT pristupavi elaborationoftheplasmadielectricwakefieldacceleratorwithaprofiledsequenceofdriverelectronbunches
AT sotnikovgv elaborationoftheplasmadielectricwakefieldacceleratorwithaprofiledsequenceofdriverelectronbunches
AT usvs elaborationoftheplasmadielectricwakefieldacceleratorwithaprofiledsequenceofdriverelectronbunches
AT zaleskiydyu elaborationoftheplasmadielectricwakefieldacceleratorwithaprofiledsequenceofdriverelectronbunches
AT onishchenkoin rozrobkaplazmovodíelektričnogokílʹvaternogopriskorûvačazprofílʹovanoûposlídovnístûdraivernihelektronnihzgustkív
AT galaydychkv rozrobkaplazmovodíelektričnogokílʹvaternogopriskorûvačazprofílʹovanoûposlídovnístûdraivernihelektronnihzgustkív
AT kniazievrr rozrobkaplazmovodíelektričnogokílʹvaternogopriskorûvačazprofílʹovanoûposlídovnístûdraivernihelektronnihzgustkív
AT krivonosovgo rozrobkaplazmovodíelektričnogokílʹvaternogopriskorûvačazprofílʹovanoûposlídovnístûdraivernihelektronnihzgustkív
AT linnikaf rozrobkaplazmovodíelektričnogokílʹvaternogopriskorûvačazprofílʹovanoûposlídovnístûdraivernihelektronnihzgustkív
AT markovpi rozrobkaplazmovodíelektričnogokílʹvaternogopriskorûvačazprofílʹovanoûposlídovnístûdraivernihelektronnihzgustkív
AT omelayenkool rozrobkaplazmovodíelektričnogokílʹvaternogopriskorûvačazprofílʹovanoûposlídovnístûdraivernihelektronnihzgustkív
AT pristupavi rozrobkaplazmovodíelektričnogokílʹvaternogopriskorûvačazprofílʹovanoûposlídovnístûdraivernihelektronnihzgustkív
AT sotnikovgv rozrobkaplazmovodíelektričnogokílʹvaternogopriskorûvačazprofílʹovanoûposlídovnístûdraivernihelektronnihzgustkív
AT usvs rozrobkaplazmovodíelektričnogokílʹvaternogopriskorûvačazprofílʹovanoûposlídovnístûdraivernihelektronnihzgustkív
AT zaleskiydyu rozrobkaplazmovodíelektričnogokílʹvaternogopriskorûvačazprofílʹovanoûposlídovnístûdraivernihelektronnihzgustkív
first_indexed 2025-12-07T15:58:06Z
last_indexed 2025-12-07T15:58:06Z
_version_ 1850865705864396800