Discrete optimization problem

In the paper a mathematical model is considered that allows simultaneous optimization of a program motion and
 an ensemble of perturbed motions. Analytical expressions for functional variations are suggested that help constructing various directed methods of optimization. Given mathematical...

Full description

Saved in:
Bibliographic Details
Published in:Вопросы атомной науки и техники
Date:2004
Main Author: Kotina, E.D.
Format: Article
Language:English
Published: Національний науковий центр «Харківський фізико-технічний інститут» НАН України 2004
Subjects:
Online Access:https://nasplib.isofts.kiev.ua/handle/123456789/78976
Tags: Add Tag
No Tags, Be the first to tag this record!
Journal Title:Digital Library of Periodicals of National Academy of Sciences of Ukraine
Cite this:Discrete optimization problem / E.D. Kotina // Вопросы атомной науки и техники. — 2004. — № 1. — С. 147-149. — Бібліогр.: 3 назв. — англ.

Institution

Digital Library of Periodicals of National Academy of Sciences of Ukraine
_version_ 1860160930695872512
author Kotina, E.D.
author_facet Kotina, E.D.
citation_txt Discrete optimization problem / E.D. Kotina // Вопросы атомной науки и техники. — 2004. — № 1. — С. 147-149. — Бібліогр.: 3 назв. — англ.
collection DSpace DC
container_title Вопросы атомной науки и техники
description In the paper a mathematical model is considered that allows simultaneous optimization of a program motion and
 an ensemble of perturbed motions. Analytical expressions for functional variations are suggested that help constructing various directed methods of optimization. Given mathematical apparatus can be effectively used in the optimization of the dynamics of charged particles in linear accelerators. Запропонована математична модель оптимізації програмного руху (руху синхронної частки) і ансамблю обурених
 рухів. Розглядаються мінімаксні функціонали, що дозволяють оцінювати динаміку часток по “найгіршим” частках. Предлагается математическая модель оптимизации программного движения (движения синхронной частицы) и ансамбля возмущенных движений. Рассматриваются минимаксные функционалы, позволяющие оценивать динамику частиц по “наихудшим” частицам.
first_indexed 2025-12-07T17:54:34Z
format Article
fulltext DISCRETE OPTIMIZATION PROBLEM E.D. Kotina Saint-Petersburg State University, Saint-Petersburg, RUSSIA In the paper a mathematical model is considered that allows simultaneous optimization of a program motion and an ensemble of perturbed motions. Analytical expressions for functional variations are suggested that help construct- ing various directed methods of optimization. Given mathematical apparatus can be effectively used in the optimiza- tion of the dynamics of charged particles in linear accelerators. PACS: 517.97:621.384.6 1. INTRODUCTION Discrete problems of control are important in the theory and practice of optimal control, because many problems are described exactly by differential equa- tions. In practice the information on the stage of the pro- cess comes in discrete moments of time and the control of the process also comes step by step. Problems of control in discrete systems received at- tention of many researches. Two approaches to the problem can be found. The first approach is based on the Bellman principle of optimality. The second one is the variational approach which links to the apparatus principle of L.S. Pontryagin. Conventional formulations of optimal control prob- lems are quite known and they had been studied quite well [1]. These problems can be considered as problems of control of particular trajectories. At the same time, in works of D.A.Ovsyannikov such methods of optimal control and optimization of ensemble of trajectories or beam trajectories have been developed [2]. Let us note that the problems of control of ensemble of trajectories naturally emerge under the study of opti- mization of charged particle beam dynamics in acceler- ating and focusing structures. 2. MATHEMATICAL MODEL Let particle dynamics be given by a difference equa- tion system: ==+ ),,()1( uxkfkx    −=−− = 1,,2)),(),2(),1(),(,( 1,0)),(),(,( 2 1 Nkkukxkxkxkf kkukxkf  (1)      −= −− = ==+ .1,,2 )),(),2(),...,(),2(),...,(,( 1,0)),(),(),(,( ),,,()1( 2 1 Nk kukykykxkxkF kkukykxkF uyxkFky  (2) Here )(kx is the −n dimensional phase vector defining the program motion, )(ky is the −m dimensional phase vector defining the perturbed motion, )(ku is the −r dimensional control vector; ),,( uxkf is the −n dimen- sional vector function defining the process dynamics at each step. For all { }Nk ,,1,0 ∈ the vector function ),,( uxkf is assumed to be definite and continuous on )(kUx ×Ω in all its arguments ),( ux along with partial derivatives with respect to these variables. ))(),(),(,( kukykxkF is the −m dimensional vector function, for all { }Nk ,,1,0 ∈ it is assumed to be defi- nite and continuous on )(kUyx ×Ω×Ω in all its argu- ments ),,( uyx along with partial derivatives with re- spect to these variables and second partial derivatives ,,, 222 ki l mi l ji l uy F xy F yy F ∂∂ ∂ ∂∂ ∂ ∂∂ ∂ ;,,2,1, mil = ;,,2,1 nm = .,,2,1 rk = Here xΩ is the region in nR , yΩ is the region in mR , 1,,1,0),( −= NkkU  is the compact set in .rR In this case we consider the Jacobian )( ))(),(),(,())(),(),(,( ky kukykxkFkukykxkJJ k ∂ ∂== to be nonzero for all changes of ).(),(),(, kukykxk The given type of system (1)-(2) is determined by the kind of discrete equations which can be described as the motion of charged particles in accelerator with drift tubes [2]. System (1)-(2) can be reduced to )).(),(),(,()1( )),(),(,()1( kukykxkFky kukxkfkx =+ =+ However, this is not useful as this leads to the rise of steps of phase vectors and the loss of physical sense of beam trajectories. We assume, that 0)0( xx = is fixed and the initial state of the system (2) is described by the set −0M a compact set of nonzero measure in mR . Let us call the sequence of vectors { })1(,),1(),0( −Nuuu  as the con- trol of the system (1)-(2) and denote it by u for brevity. Its associated sequence of vectors { })(,),1(),0( Nxxx  is called the trajectory of program motion and is de- noted by ),( 0 uxxx = . Denote by ),,()( 0 uxkxkx = the phase state of the program particle at k th step. Simil- arly, let us call the sequence of vectors { })(,),1(),0( Nyyy  as the trajectory of perturbed mo- tion and denote it by ),,( 0 uyxyy = . Denote by ),,,()( 0 uyxkyky = the phase state of the particle at the k -th step. The set of trajectories ),,( 0 uyxy corresponding to the initial state 0x , the control u and different states 00 My ∈ will be referred to as a bundle of trajectories or simply the bundle. The phase state of beam at the k ___________________________________________________________ PROBLEMS OF ATOMIC SIENCE AND TECHNOLOGY. 2004. № 1. Series: Nuclear Physics Investigations (42), p.147-149. 147 th step is also called as the cross section of the bundle of trajectories and is denoted by ukM , , i.e. { } ,),,,,()(:)( 000, MyuxykykykyM uk ∈== the controls satisfying conditions 1,,1,0),()( −=∈ NkkUku  are admissible. We introduce the following functionals: ,)()()( 1 1 1 ∑ − = += N k NNNkkk xgcxgcuI (3) ∫∑ ∫ += − = uNuk M NN N k M kkkkk dyygdyuyxuI ,, )(),,()( 1 1 2 ϕ , (4) )()()( 21 uIuIuI += (5) characterizing the phase state of the bundle of trajecto- ries and the control parameters. Here ),(kxxk = ,)( ,ukk Mkyy ∈= the function kϕ is defined and con- tinuous on )(kUyx ×Ω×Ω for all k in all its argu- ments together with partial derivatives with respect to yx, and u ; kg is continuously differentiable function defined in xΩ for all k ; g is a continuously differenti- able function defined in yΩ , kc is constant for all k . Functional (3) characterizes the dynamics of the pro- gram motion, functional (4) characterizes the dynamics of the ensemble of perturbed motions, while functional (5) allows simultaneous estimation of the program and perturbed motions as well as their simultaneous optim- ization. We will consider the functional minimization problem for all admissible controls. 3. VARIATION OF FUNCTIONAL Let us consider the admissible control u and u~ . Their associated trajectories are denoted by ),( 0 uxx and )~,(~ 0 uxx , and associated trajectories of perturbed motions are denoted by ),,( 0 uyxy и )~,,~(~ 0 uyxy . (6) The difference )()(~)( kukuku −=∆ is called the varia- tional of the control u at the k th step, difference ),,()~,,(~),()( 00 uxkxuxkxxkxkx k −=∆=∆ is called the trajectory increment ),( 0 uxx at the k th step, and the difference ),,()~,,~(~),()( 00 uyxyuyxyykyky k −=∆=∆ is called the trajectory increment of perturbed motion at the k th step. With u∆ and yx ∆∆ , referred to as the variation of control u and the increments of trajectories of ),( 0 uxx and ),,( 0 uyxy respectively. It is evident that, by the common properties of continuity 0→∆ x as 0→∆ u , and 0→∆ y as 0→∆ u uniformly in 00 My ∈ , )(max 1,,1,0 kxx Nk ∆=∆ −=  , here ))(),(()( kxkxkx ∆∆=∆ . The norm y∆ and norm u∆ are defined in a similar manner. Let us denote variations of trajectories of the system (1) − (2) as )(),( kykx δδ at admissible variation of con- trol u∆ and given u . Now we will write down for system (1) − (2) ac- cording equations in variations: ),( )( )( )( )( )( )1( ku ku kfkx kx kfkx ∆ ∂ ∂ + ∂ ∂ =+ δδ 1,0=k ),( )( )()2( )2( )( )1( )1( )()( )( )()1( ku ku kfkx kx kf kx kx kfkx kx kfkx ∆ ∂ ∂+− −∂ ∂ +− −∂ ∂+ ∂ ∂=+ δ δδδ 1,,2 −= Nk  , (7) ),( )( )()( )( )()( )( )()1( ku ku kFky ky kFkx kx kFky ∆ ∂ ∂+ ∂ ∂+ ∂ ∂=+ δδδ 1,0=k , +− −∂ ∂+− −∂ ∂+ ∂ ∂+ − −∂ ∂+− −∂ ∂+ ∂ ∂=+ )2( )2( )()1( )1( )()( )( )( )2( )2( )()1( )1( )()( )( )()1( ky ky kFky ky kFky ky kF kx kx kFkx kx kFkx kx kFky δδδ δδδδ ),( )( )( ku ku kF ∆ ∂ ∂ .1,,2 −= Nk  (8) In this case, xx δ−∆ and yy δ−∆ are infinitesimals of higher order than u∆ . Let us consider the mapping of the set ukM , into the set ukM ~, that is defined by the trajectories (6) emanat- ing from the same points of the set 0M . Denote it by )(~~ kk yyy = . (9) Let us write down the Jacobian of this transformation [2]: ( ),),(),(1 ~ det kky k k ykyoykydiv y y ∆+∆+=    ∂ ∂ where ∑ = ∂ ∆∂=∆ m i i i ky ky kykyykydiv 1 )( ))(,()),( . Furthermore, by the above assumptions, ( )uoykydivykydiv kyky ∆=δ−∆ ),(),( is uniform with respect to Nk ,,2,1 = and 00 My ∈ . Similarly [2], it is easy to show, that there take place following relationships: ,)( )( )( )( )( )( )()1( 1     ∆ ∂ ∂+ ∂ ∂+ ∂ ∂ +=+ − ku ku Jkx kx Jky ky JJ kydivkydiv kkk k yy δδ δδ 1,0=k ,   + ∂ ∂ +=+ − )( )( )()1( 1 ky ky JJkydivkydiv k kyy δδδ + ∂ ∂ +− −∂ ∂ +− −∂ ∂ )( )( )2( )2( )1( )1( kx kx Jky ky Jky ky J kkk δδδ ,)( )( )2( )2( )1( )1(   ∆ ∂ ∂ +− −∂ ∂ +− −∂ ∂ + ku ku J kx kx J kx kx J kkk δδ 1,,2 −= Nk  . (10) Taking into account equations (7), (8), (10) and initial values of variations ,0)0(,0)0( =δ=δ yx 148 ,0)0( =ydivyδ and using the methods of investigation of functionals of types (3)-(5), presented at the works [1-2, 4] variations of functionals (3)-(5) (at admissible variation of control u∆ ) can be represented in the fol- lowing form: ),( )( ))(),(,( )1( 1 0 1 ku ku kukxkfkI N k T ∆ ∂ ∂ += ∑ − = ξδ (11) where )(kξ is the following auxiliary function: , )( )( )( )()1()( kx xg c kx ifik kk k m ki TT ∂ ∂ + ∂ ∂+= ∑ = ξξ here 3,,2,1 2,1 ,2 ,1 −= −−=    + − = Nkпри NNkпри k N m  ,1,,2,1 −= Nk  with the terminal condition , )( )( )( Nx xgcN NN N T ∂ ∂ =ξ )(kξ  n -vector; + ∂ ∂++  ∂ ∂+= ∑ ∫ − = )( )()1( )( )()1( 1 0 2 , ku kfkJ ku kFkpJI T k N k M T j uk γδ ),( )( ))(),(),(( )( )1( kudy ku kukykx ku Jkq k kk ∆  ∂ ∂+ ∂ ∂+ ϕ (12) here )(),(),( kkpkq γ are the following auxiliary func- tions: ,)1()( kk kqJkq ϕ++= , )( ))(),(),(( )( )()1( )( )1()( 1 ky kukykx ky iFipJ ky JiqJkp k m ki i kj T j i m ki i kj j T ∂ ∂+ ∂ ∂+ + ∂ ∂+= ∑ ∏ ∑ ∏ = = = − = ϕ +    ∂ ∂+= ∑ ∏ = − = m ki i kj i j T kx JiqJk 1 )( )1()(γ +  ∂ ∂++ ∂ ∂+∏ ∏ = = i kj i kj T j T j kx ifiJ kx iFipJ )( )()1( )( )()1( γ , )( ))(),(),(( ky kukykxk ∂ ∂ ϕ here    −−=− −=+ = 1,2,1 3,,1,2 NNkN Nkk m  , if ,1−> ik then let be 1 1 =∏ − = i kj jJ ; with the terminal conditions: ,0)(),()(, )( )()( =γ= ∂ ∂= NygNq Ny ygNp N NT here )(kγ is the n -vector, )(kp is the m -vector, )(kq is the scalar. The variation of functional (5) has the following form: .21 III δδδ += (13) The relationships (11), (12) can be written in the follow- ing form ,11 ugradII ∆=δ ,22 ugradII ∆=δ where , )1( )1()(,, )1( )0()1(1     −∂ −∂ ∂ ∂= Nu NfN u fgradI TT ξξ  and components of 2gradI will be integrals on ukM , of corresponding expressions in brackets in formula (12). Obviously, the sum of these gradients will be the gradi- ent of functional (5). The representation of functional variations (11)-(13) allows constructing a variety of directional methods of optimization for functionals (3)-(5). In particular, we can use the gradient methods of optimization. 4. CONCLUSION In this paper we considered the mutual optimization of a particular trajectory and the ensemble of trajecto- ries. Analytical representations for variations of exam- ined functionals were found. Note that we often find ne- cessity of joint optimization in solving various opti- mization problems, in particular, in the problems of charged particle beam dynamic optimization in linear accelerators [3]. 5. ACNOWLEDGEMENTS The Russian Fond of Fundamental Researches, pro- ject 03-01-00726, supported this work. REFERENCES 1. A.I.Propoy. Elements of the Theory of Optimal Discrete Processes // Nauka publishing house. M.; 1973 (in Russian) 2. D.A.Ovsyannikov. Modelling and Optimization of Charged Particle Beam Dynamics. Leningrad State University publishing house, Leningrad, 1990 (in Russian) 3. B.I.Bondarev, A.P.Durkin, A.D.Ovsyannikov. New Mathematical Optimization Models for RFQ Struc- tures // Proc. of Particle Accelerator Conference, New York. 1999, p.2808-2810, ОПТИМИЗАЦИЯ В ДИСКРЕТНЫХ СИСТЕМАХ ПРИ МИНИМАКСНОМ КРИТЕРИИ Е.Д. Котина Предлагается математическая модель оптимизации программного движения (движения синхронной частицы) и ан- самбля возмущенных движений. Рассматриваются минимаксные функционалы, позволяющие оценивать динамику ча- стиц по “наихудшим” частицам. ОПТИМІЗАЦІЯ В ДИСКРЕТНИХ СИСТЕМАХ ПРИ МІНІМАКСНОМУ КРИТЕРІЇ Є.Д. Котина ___________________________________________________________ PROBLEMS OF ATOMIC SIENCE AND TECHNOLOGY. 2004. № 1. Series: Nuclear Physics Investigations (42), p.147-149. 149 Запропонована математична модель оптимізації програмного руху (руху синхронної частки) і ансамблю обурених рухів. Розглядаються мінімаксні функціонали, що дозволяють оцінювати динаміку часток по “найгіршим” частках. 150 Discrete Optimization Problem 1. Introduction Е.Д. Котина
id nasplib_isofts_kiev_ua-123456789-78976
institution Digital Library of Periodicals of National Academy of Sciences of Ukraine
issn 1562-6016
language English
last_indexed 2025-12-07T17:54:34Z
publishDate 2004
publisher Національний науковий центр «Харківський фізико-технічний інститут» НАН України
record_format dspace
spelling Kotina, E.D.
2015-03-24T15:35:06Z
2015-03-24T15:35:06Z
2004
Discrete optimization problem / E.D. Kotina // Вопросы атомной науки и техники. — 2004. — № 1. — С. 147-149. — Бібліогр.: 3 назв. — англ.
1562-6016
PACS: 517.97:621.384.6
https://nasplib.isofts.kiev.ua/handle/123456789/78976
In the paper a mathematical model is considered that allows simultaneous optimization of a program motion and
 an ensemble of perturbed motions. Analytical expressions for functional variations are suggested that help constructing various directed methods of optimization. Given mathematical apparatus can be effectively used in the optimization of the dynamics of charged particles in linear accelerators.
Запропонована математична модель оптимізації програмного руху (руху синхронної частки) і ансамблю обурених
 рухів. Розглядаються мінімаксні функціонали, що дозволяють оцінювати динаміку часток по “найгіршим” частках.
Предлагается математическая модель оптимизации программного движения (движения синхронной частицы) и ансамбля возмущенных движений. Рассматриваются минимаксные функционалы, позволяющие оценивать динамику частиц по “наихудшим” частицам.
The Russian Fond of Fundamental Researches, project 03-01-00726, supported this work.
en
Національний науковий центр «Харківський фізико-технічний інститут» НАН України
Вопросы атомной науки и техники
Динамика пучков
Discrete optimization problem
Оптимізація в дискретних системах при мінімаксному критерії
Оптимизация в дискретных системах при минимаксном критерии
Article
published earlier
spellingShingle Discrete optimization problem
Kotina, E.D.
Динамика пучков
title Discrete optimization problem
title_alt Оптимізація в дискретних системах при мінімаксному критерії
Оптимизация в дискретных системах при минимаксном критерии
title_full Discrete optimization problem
title_fullStr Discrete optimization problem
title_full_unstemmed Discrete optimization problem
title_short Discrete optimization problem
title_sort discrete optimization problem
topic Динамика пучков
topic_facet Динамика пучков
url https://nasplib.isofts.kiev.ua/handle/123456789/78976
work_keys_str_mv AT kotinaed discreteoptimizationproblem
AT kotinaed optimízacíâvdiskretnihsistemahprimínímaksnomukriteríí
AT kotinaed optimizaciâvdiskretnyhsistemahpriminimaksnomkriterii