Spatial Dynamic and Ecology of a Male Eurasian Lynx, Lynx lynx (Carnivora, Felidae), in Volyn Polissia, Ukraine: First GPS-GSM Telemetry Findings

In landscapes affected by human activity, understanding the spatial dynamics, predation behaviour and habitat preferences of large carnivores is essential for developing effective conservation strategies. The Eurasian lynx (Lynx lynx) plays a vital role in maintaining the ecological balance of tempe...

Ausführliche Beschreibung

Gespeichert in:
Bibliographische Detailangaben
Veröffentlicht in:Zoodiversity (Vestnik Zoologii)
Datum:2025
Jahrgang:59
Heft:4
ISSN:2707-7268
Автори та афіліації:
  • R. M Cherepanyn — WWF-Ukraine, Vasyl Stefanyk Precarpathian National University Ivano-Frankivsk, Ukraine — ORCID: 0000-0002-2227-3697
  • M. V. Franchuk — Nature Reserve «Rivnenskyi», «Dubky tract» Str., 1, Chudel village, Sarny district, Rivne region, Ukraine — ORCID: 0000-0002-7044-7137
  • J. Kubala — Technical University in Zvolen, T. G. Masaryka St., 24, Zvolen, 96001, Slovakia
  • Y. M. Andreychuk — Ivan Franko National University of Lviv, Universytetska St., 1, Lviv, Ukraine — ORCID: 0000-0002-4940-4319
  • T. S. Yamelynets — World Wide Fund for Nature Ukraine (WWF-Ukraine), Raisy Okipnoi St., 4, office 170, Kyiv, 02002, Ukraine; Ivan Franko National University of Lviv, Universytetska Str., 1, Lviv, 79000, Ukraine
  • J. Signer — Wildlife Science, Faculty of Forest Science and Forest Ecology, University of Goettingen, Büsgenweg 5, Göttingen, 37077, Germany
  • B. I. Vykhor — World Wide Fund for Nature Ukraine (WWF-Ukraine), Raisy Okipnoi St., 4, office 170, Kyiv, 02002, Ukraine
  • I. V. Dykyy — World Wide Fund for Nature Ukraine (WWF-Ukraine), Raisy Okipnoi St., 4, office 170, Kyiv, Ukraine; Ivan Franko National University of Lviv, Universytetska St., 1, Lviv, 79000, Ukraine
Hauptverfasser: Cherepanyn, R. M, Franchuk, M. V., Kubala, J., Andreychuk, Y. M., Yamelynets, T. S., Signer, J., Vykhor, B. I., Dykyy, I. V.
Format: Artikel
Sprache:Englisch
Veröffentlicht: Publishing House "Akademperiodyka" of the National Academy of Sciences of Ukraine 2025
Online Zugang:https://ojs.akademperiodyka.org.ua/index.php/Zoodiversity/article/view/730
Tags: Tag hinzufügen
Keine Tags, Fügen Sie den ersten Tag hinzu!
Назва журналу:Zoodiversity
Завантажити файл: Pdf

Institution

Zoodiversity
_version_ 1874092744032387072
author Cherepanyn, R. M
Franchuk, M. V.
Kubala, J.
Andreychuk, Y. M.
Yamelynets, T. S.
Signer, J.
Vykhor, B. I.
Dykyy, I. V.
author_facet Cherepanyn, R. M
Franchuk, M. V.
Kubala, J.
Andreychuk, Y. M.
Yamelynets, T. S.
Signer, J.
Vykhor, B. I.
Dykyy, I. V.
author_institution_txt_mv [ { "author": "R. M Cherepanyn", "institution": "WWF-Ukraine, Vasyl Stefanyk Precarpathian National University Ivano-Frankivsk, Ukraine", "orcid": "0000-0002-2227-3697" }, { "author": "M. V. Franchuk", "institution": "Nature Reserve «Rivnenskyi», «Dubky tract» Str., 1, Chudel village, Sarny district, Rivne region, Ukraine", "orcid": "0000-0002-7044-7137" }, { "author": "J. Kubala", "institution": "Technical University in Zvolen, T. G. Masaryka St., 24, Zvolen, 96001, Slovakia", "orcid": "" }, { "author": "Y. M. Andreychuk", "institution": "Ivan Franko National University of Lviv, Universytetska St., 1, Lviv, Ukraine", "orcid": "0000-0002-4940-4319" }, { "author": "T. S. Yamelynets", "institution": "World Wide Fund for Nature Ukraine (WWF-Ukraine), Raisy Okipnoi St., 4, office 170, Kyiv, 02002, Ukraine; Ivan Franko National University of Lviv, Universytetska Str., 1, Lviv, 79000, Ukraine ", "orcid": "" }, { "author": "J. Signer", "institution": "Wildlife Science, Faculty of Forest Science and Forest Ecology, University of Goettingen, Büsgenweg 5, Göttingen, 37077, Germany", "orcid": "" }, { "author": "B. I. Vykhor", "institution": "World Wide Fund for Nature Ukraine (WWF-Ukraine), Raisy Okipnoi St., 4, office 170, Kyiv, 02002, Ukraine ", "orcid": "" }, { "author": "I. V. Dykyy", "institution": "World Wide Fund for Nature Ukraine (WWF-Ukraine), Raisy Okipnoi St., 4, office 170, Kyiv, Ukraine; Ivan Franko National University of Lviv, Universytetska St., 1, Lviv, 79000, Ukraine ", "orcid": "" } ]
author_orcid_str_mv 0000-0002-2227-3697
0000-0002-7044-7137
0000-0002-4940-4319
author_sort Cherepanyn, R. M
baseUrl_str https://ojs.akademperiodyka.org.ua/index.php/Zoodiversity/oai
collection OJS
container_end_page
container_issue 4
container_start_page
container_title Zoodiversity (Vestnik Zoologii)
container_volume 59
datestamp_date 2026-08-20T12:37:07Z
description In landscapes affected by human activity, understanding the spatial dynamics, predation behaviour and habitat preferences of large carnivores is essential for developing effective conservation strategies. The Eurasian lynx (Lynx lynx) plays a vital role in maintaining the ecological balance of temperate and boreal forests in Europe and Asia. However, the ecological patterns and behavior of lynx populations in Ukraine remain poorly studied. This study, based on GPS telemetry data collected from February to August 2023 in the Rivnenskyi Nature Reserve and adjacent territories, is the first to provide a comprehensive assessment of lynx home range, predation ecology and habitat selection in Ukraine. The average annual home range size of the lynx ranged from 181 to 255 km², depending on the home range estimator used (95 % MCP, KDE, and AKDE), with significant seasonal variation: larger ranges in summer (172 km², 95 % MCP) compared to smaller winter ranges (113.2 km², 95 % MCP). The lynx primarily preyed on roe deer (Capreolus capreolus) and brown hare (Lepus europaeus), occasionally targeting smaller prey and carnivores, including the raccoon dog (Nyctereutes procyonoides). Kills and resting sites were located in dense, low-visibility areas such as swampy coniferous and deciduous forests. Moreover, the study demonstrated that lynx actively avoided human settlements and roads, particularly during summer, highlighting the influence of anthropogenic factors. While our findings align with patterns observed in other European lynx populations, they also reveal regional variations driven by local landscape features. Of the lynx telemetry observations, 30.5% occurred within protected areas and 69.5% in forestry enterprises, degraded marshlands and hunting grounds. These results emphasise the importance of spatial ecology in carnivore conservation and highlight the need for continued monitoring to assess the impact of human activity on lynx populations in Ukraine. Furthermore, this study provides valuable insights for developing targeted conservation strategies involving local communities and stakeholders for the species in Ukraine and Eastern Europe. It also emphasises the need for standardised monitoring to facilitate comparative analyses of lynx ecology across different regions, including the Baltic and the Carpathians.
doi_str_mv 10.15407/zoo2025.04.327
first_indexed 2025-09-17T09:33:41Z
format Article
fulltext DOI 10.15407/zoo2025.04.327 UDC 599.742.75:621.398(438.42:477.82) SPATIAL DYNAMIC AND ECOLOGY OF A MALE EURASIAN LYNX, LYNX LYNX (CARNIVORA, FELIDAE), IN VOLYN POLISSIA, UKRAINE: FIRST GPS-GSM TELEMETRY FINDINGS R. M. Cherepanyn 1, 2, *, M. V. Franchuk 3, J. Kubala 4, Y. M. Andreychuk 5, T. S. Yamelynets 1, 5, J. Signer 6, В. I. Vykhor 1, I. V. Dykyy 1, 5 1 World Wide Fund for Nature Ukraine (WWF-Ukraine), Raisy Okipnoi st., 4, office 170, Kyiv, 02002 Ukraine 2 Vasyl Stefanyk Precarpathian National University, Taras Shevchenko st., 54, Ivano-Frankivsk, 76018 Ukraine 3 Nature Reserve “Rivnenskyi”, “Dubky tract” st., 1, Chudel village, Sarny District, Rivne Region, 34542 Ukraine 4 Technical University in Zvolen, T. G. Masaryka st., 24, Zvolen, 96001 Slovakia 5 Ivan Franko National University of Lviv, Universytetska st., 1, Lviv, 79000 Ukraine 6 Wildlife Science, Faculty of Forest Science and Forest Ecology, University of Goettingen, Büsgenweg 5, Göttingen, 37077 Germany * Corresponding author E-mails: rcherepanyn@wwf.ua, roman.cherepanyn@pnu.edu.ua, roman.cherepanyn@gmail.com R. Cherepanyn: https://orcid.org/0000-0002-2227-3697 M. Franchuk: https://orcid.org/0000-0002-7044-7137 J. Kubala: https://orcid.org/0000-0003-2051-508X Y. Andreychuk: https://orcid.org/0000-0002-4940-4319 T. Yamelynets: https://orcid.org/0000-0002-7058-0931 J. Signer: https://orcid.org/0000-0002-1771-7775 B. Vykhor: https://orcid.org/0000-0002-1856-1776 I. Dykyy: https://orcid.org/0000-0003-3625-8567 urn:lsid:zoobank.org:pub:86BEE72B-862B-48C3-AAD7-9E05FAB864EC Ecology Zoodiversity, 59(4):327–348, 2025 © Publisher Publishing House "Akademperiodyka" of the NAS of Ukraine, 2025. The article is published under an open access license CC BY-NC-ND (https://creativecommons.org/licenses/ by-nc-nd/4.0/) ISSN 2707-725X. Zoodiversity. 2025. Vol. 59, No. 4 Spatial Dynamic and Ecology of a Male Eurasian Lynx, Lynx lynx (Carnivora, Felidae), in Volyn Polissia, Ukraine: First GPS-GSM Telemetry Findings. Сherepanyn, R. M., Fran- chuk,  M.  V., Kubala, J., Andreychuk, Y. M., Yamelynets, T. S., Signer, J., Vykhor, B. I. & Dykyy, I. V. — In landscapes affected by human activity, understanding the spatial dynam- R. M. Cherepanyn, M. V. Franchuk, J. Kubala, Y. M. Andreychuk , T. S. Yamelynets et al. ISSN 2707-725X. Zoodiversity. 2025. Vol. 59, No. 4 328 ics, predation behaviour and habitat preferences of large carnivores is essential for developing effective conservation strategies. The Eurasian lynx, Lynx lynx Linnaeus, 1758, plays a vital role in maintaining the ecological balance of temperate and boreal forests in Europe and Asia. However, the ecological patterns and behavior of lynx populations in Ukraine remain poorly studied. This study, based on GPS telemetry data collected from February to August 2023 in the Rivnenskyi Nature Reserve and adjacent territories, is the first to provide a comprehensive assessment of lynx home range, predation ecology and habitat selection in Ukraine. The aver- age annual home range size of the lynx ranged from 181 to 255 km², depending on the home range estimator used (95% MCP, KDE, and AKDE), with significant seasonal variation: larger ranges in summer (172 km², 95% MCP) compared to smaller winter ranges (113.2 km², 95% MCP). The lynx primarily preyed on roe deer (Capreolus capreolus) and brown hare (Lepus eu- ropaeus), occasionally targeting smaller prey and carnivores, including the raccoon dog (Nyc- tereutes procyonoides). Kills and resting sites were located in dense, low-visibility areas such as swampy coniferous and deciduous forests. Moreover, the study demonstrated that lynx actively avoided human settlements and roads, particularly during summer, highlighting the influence of anthropogenic factors. While our findings align with patterns observed in other European lynx populations, they also reveal regional variations driven by local landscape features. Of the lynx telemetry observations, 30.5% occurred within protected areas and 69.5% in forestry en- terprises, degraded marshlands and hunting grounds. These results emphasise the importance of spatial ecology in carnivore conservation and highlight the need for continued monitoring to assess the impact of human activity on lynx populations in Ukraine. Furthermore, this study provides valuable insights for developing targeted conservation strategies involving local com- munities and stakeholders for the species in Ukraine and Eastern Europe. It also emphasises the need for standardised monitoring to facilitate comparative analyses of lynx ecology across different regions, including the Baltic and the Carpathians. Key words: Eurasian lynx, home range, MCP, KDE, AKDE, Polissia, Ukraine. Introduction The spatial dynamics of large carnivores, including their home range size, habitat selection and movement patterns, are primarily driven by the need to secure vital resources (Gittleman & Harvey, 1982; Boitani & Powell, 2012; Gittleman, 2013). These behaviours are shaped by prey availability, competition, human activity and habitat fragmentation. Predation ecology, including diet, hunting strategies and prey selection, is closely linked to spatial behaviour (Sunquist & Sunquist, 1989; 2020). Understanding these dynamics is crucial for the effective conservation of large car- nivores, particularly in human-dominated landscapes where they face challenges due to their extensive spatial requirements (Breitenmoser & Breitenmoser-Würsten, 2008; Linnell et al., 2021; Kubala et al., 2024). Accurate home range estimates are essential for assessing population trends, understanding habitat suitability, and in- forming conservation strategies. Yet, landscapes’ inherent variability poses signifi- cant challenges to data collection and the reliable extrapolation of findings across different regions (Herfindal et al., 2005; Palmero et al., 2023 a, b). Although the adaptive predation strategies of large carnivores highlight their behavioural plastici- ty, they also complicate conservation efforts, particularly in areas where prey is scarce or human-wildlife conflict is prevalent (Linnell et al., 2001; Schmidt, 2008; Nagl et al., 2022; Cherepanyn et al., 2023 c, 2024). Another biological function that affects spatial dynamics in large carnivores is resting, which shapes habitat use, territoriali- ty, and intraspecific competition (Kolowski & Woolf, 2002; Signer et al., 2019; Spatial Dynamic and Ecology of A Male Eurasian Lynx, Lynx lynx (Carnivora, Felidae)... ISSN 2707-725X. Zoodiversity. 2025. Vol. 59, No. 4 329 Hočevar et al., 2021). Understanding these relationships enhances our knowledge of carnivore ecology and informs conservation strategies to support their complex hab- itat needs (Podgórski et al., 2008; Filla et al., 2017). The Eurasian lynx (Lynx lynx) is a generalist carnivore inhabiting boreal and temperate forests throughout Europe and Asia (Breitenmoser et al., 2015; von Arx, 2020, Kaczensky et al., 2024). The size of the lynx’s home range varies considerably across Europe (Kubala et al., 2024), influenced by factors including sex, age (Schmidt et al., 1997; Sunde et al., 2000; Melovski et al., 2020), prey availability, environmental productivity (Herfindal et al., 2005; Breitenmoser-Würsten et al., 2007), and conspecific density (Pesenti & Zimmermann, 2013; Aronsson et al., 2016). As an apex predator, it profoundly impacts prey populations, particularly ungulates (Breitenmoser & Breitenmoser-Würsten, 2008; Andrén & Liberg, 2024). Although the diet of lynx in Europe ranges from small rodents to red deer (Cervus elaphus), they are specialist predators that primarily target roe deer (Capreolus ca- preolus) when available (Molinari-Jobin et al., 2007; Melovski et al., 2020; Oliveira et al. 2024). Lynx spatial dynamics and resting site selection is influenced by sever- al key survival factors that help them conserve energy, avoid detection, and stay close to resources (Sunde et al., 1998; Filla et al., 2017; Belotti et al., 2012). Inte- grating spatial ecology with studies on predation and resting behaviours provides a more comprehensive understanding of how lynx interact with their environment and contribute to ecosystem stability. These insights are crucial for informing con- servation strategies, mitigating human-wildlife conflicts, and ensuring the long- term viability of lynx populations (Linnell et al., 2021). However, despite extensive research on lynx ecology in Europe, relevant information from Ukraine remains limited or scarce (Cherepanyn et al., 2023 a). The lynx has been listed in Ukraine’s Red Data Book since 1993 (Shcherbak, 1994; Akimov, 2009) and classified as “vulnerable” in 2021 (Order of the Ministry of Environmental Protection and Natural Resources of Ukraine, No. 29). It is protected under Appendix III of the Berne Convention, Appendix II of CITES, and is listed on the International Union for Conservation of Nature (IUCN) Red List (von Arx, 2020). The country’s conservation plan for the species was adopted in 2021 accord- ing to Order No. 595 (Action Plan, 2021). In Ukraine, the lynx is widespread in two biogeographical zones — the Carpathians and Polissia, belonging to the Carpathian and Baltic populations (Breitenmoser et al., 2015; Kaczensky et al., 2024). In 2019, official data recorded 435 lynx in the Carpathians and 128 in Polissia (Cherepanyn et al., 2023 a), while the Red Data Book estimated 350–400 and 80–90, respectively (Akimov, 2009). Lynx population estimates vary due to differing assessment meth- ods and unsynchronized monitoring and data exchange between institutions (Vyk- hor et al., 2022). Although the first radio-telemetry study was conducted in 2003 in the Polissia Nature Reserve (Shkvyrya, 2005; Zhyla, 2012), a significant gap remains in empirical research on the ecology and spatial dynamics of lynx in Ukraine, par- ticularly concerning home range size, predation, resting and the ecological factors constraining the species to specific areas based on telemetry data (Kubala et al., 2021; Cherepanyn et al., 2023 b). Therefore, our study aims to: 1) gain insight into the spa- tial needs of the lynx in Ukraine by estimating individual home-range sizes, 2) pro- vide the first reliable data on lynx predation by monitoring feeding behavior through R. M. Cherepanyn, M. V. Franchuk, J. Kubala, Y. M. Andreychuk , T. S. Yamelynets et al. ISSN 2707-725X. Zoodiversity. 2025. Vol. 59, No. 4 330 prey species analysis and 3) compare our findings with data from other lynx studies. Finally, we discuss remaining ecological knowledge gaps, offer recommendations for future research, and explore the implications of our results for practical management and conservation efforts of the Eurasian lynx in Ukraine. Material and Methods Study area Our study was conducted within the biogeographical zone of Volyn Polissia (Fig. 1) in the Rivnenskyi Nature Reserve — Somyne Massif, Sarnensky Dis- trict, Rivne Oblast (IUCN Category Ia, Ramsar sites), in the local importance botanical zakaznyk “Velykoozerianskyi” (zakaznyk, a form of nature protection in Ukraine that designates areas for the sustainable use of natural resources) and the adjacent lands of forestry (Klesiv and Sarny forestry enterprises) and agricultural purpose in the northwest part of Ukraine. The study area, covering a total of 362 km², is characterised by flat terrain, predominantly sandy soils, excess moisture, dense forestation, and the presence of swamps. The climate in the region is marked by notable seasonal temperature variations, with warm summers. The forests of Volyn Polissia primarily consist of oak-hornbeam (Quercus robur L. — Carpinus betulus L.), pine-oak (Pinus sylvestris L. — Quer- cus robur L.), and shrub plant communities, covering approximately 40% of the area. Meadow-swamp plant communities occupy around 10% of the territory (Marynych, 1993, 2007). According to the landscape zoning classification by Marynych et al. (2007), the study area is part of the plain landscapes within the coniferous-broadleaf forest group, divided into the following subgroups: (1) al- Fig. 1. The study area is situated within the Volyn Polissia region, located in the north-western part of Ukraine Spatial Dynamic and Ecology of A Male Eurasian Lynx, Lynx lynx (Carnivora, Felidae)... ISSN 2707-725X. Zoodiversity. 2025. Vol. 59, No. 4 331 luvial-sand plains, flat and undulating, characterised by sod-podzolic soils and lowland swamps predominantly covered by pine (Pinus sylvestris L.) forests and subors (90%); (2) outwash plains, flat and undulating, with sod-podzolic and sod soils, lowland swamps, and isolated patches of pine forests, subors, and al- der stands (5%); and (3) floodplain landscapes of the plains, consisting of for- ested areas and meadow-swamp ecosystems (5%). The massif is predominantly covered by forest, aquatic, and swamp vegetation, with isolated areas of psam- mophytic and meadow vegetation (Akimov, 2009). The fauna comprises 46 mammal species, with rodents being the most numerous group, alongside roe deer (Capreolus capreolus), wild boar (Sus scrofa), elk (Alces alces), brown hare (Lepus europaeus), Eurasian beaver (Castor fiber), red fox (Vulpes vulpes) raccoon dog (Nyctereutes procyonoides) and grey wolf (Canis lupus). Moreover, the area is characterised by a relatively low density of human settlements and population. Lynx captures and col lar ing For lynx captures, we utilised walk-through, double-door wooden box traps (meas- uring 2×1×1 m), strategically positioned in areas identified through prior systematic monitoring as frequently visited by lynx (Vykhor et al., 2022). Lynx capture efforts were conducted during winter and early spring, aligning with the period of increased spatial activity, especially during the mating season. The box traps were continuous- ly monitored through a GSM alarm system (Trapmaster, Germany) and camera traps (Bushwacker Big Eye D3N Camera, China; Willfine WG-4.0CG-GPS Camera, Chi- na). These systems promptly alerted the responsible personnel if a trap doors closed. On February 4, 2023, an adult male lynx was successfully captured (Fig. 2). The lynx was tranquillised by a veterinarian using a combination of medetomidine (Domi- tor®) and ketamine (Ketasol® and Narketan®), with atipamezole (Antisedan®) admin- Fig. 2. An adult male lynx captured on February 4, 2023, during a tranquilization, medical exam- ination, and collaring procedure in the Nature Reserve “Rivnenskyi” R. M. Cherepanyn, M. V. Franchuk, J. Kubala, Y. M. Andreychuk , T. S. Yamelynets et al. ISSN 2707-725X. Zoodiversity. 2025. Vol. 59, No. 4 332 istered as a reversal agent (LifeLynx, 2018; Signer et al., 2021; Kubala et al., 2024). This study adheres to the ARRIVE guidelines (Percie du Sert et al., 2020) and all procedures were approved by the Ministry of Environmental Protection and Natural Resources of Ukraine (Approval No. 2022/4). The captured lynx underwent a medi- cal examination and was fitted with a GPS-GSM collar, equipped with a drop-off mechanism, providing online access to data stored on the server (Ecotone, Poland). We recorded the animal’s sex and weight (22 kg), and estimated its age (4–5 years old) based on tooth wear (Marti & Ryser-Degiorgis, 2018 a, b) and data from system- atic camera trapping. After the protocol, the lynx was released at the capture site. The collar was programmed to collect four GPS fixes every 24 hours, with a 6-hour inter- val between each fix. No mortalities or complications occurred during or after the capture, and none were observed due to collaring. Spat ia l ana lys is Spatial-temporal geodata of the GPS tracker were processed using a geographic in- formation system ArcGIS Pro 3.2.2 licensed software (ESRI, Redlands, CA, USA, 2016; Andreichuk & Yamelynets, 2015; Chaskovskyy et al., 2021). We calculated an- nual, seasonal, and monthly home ranges for lynx using 9% 100%, and 50% (core area) Minimum Convex Polygons (MCP; Mohr, 1947), Kernel home ranges (KDE; Worton, 1989), and Autocorrelated Kernel home ranges (AKDE; Fleming et al., 2015) to facilitate comparisons with previous studies. Based on the geographic sim- ilarity to the lynx population in the Białowieża Primeval Forest, Poland, and the annual variation in its movement patterns, we followed the definitions of Jędrzejew- ski et al. (1996) and Schmidt et al. (1997) to delineate two distinct seasons: (1) a pe- riod of low movement rates, corresponding to spring and summer (May 1 to Sep- tember 30, hereafter referred to as “summer”), and (2) a period of high movement rates, corresponding to autumn and winter (October 1 to April 30, hereafter referred to as “winter”). We further defined the breeding season as February 1 to March 31, and the non-breeding season as April 1 to January 31. To calculate the annual home range, a minimum of 6 months of data was required (Herfindal et al., 2005; White et al., 2015; Kubala et al., 2024). For the seasonal home range, at least 20 locations were necessary (Linnell et al., 2001; White et al., 2015), while monthly home ranges re- quired at least 14 location points. We defined a lynx’s home range as established and permanent when it exhibited a consistent polygonal movement pattern, excluding locations that represented excursions of adult lynx. Home ranges were calculated using the amt and ctmm packages (Calabrese et al., 2016; Signer et al., 2019) within the R statistical environment (R Core Team, 2021). Predat ion and anthropogenic impact We used ArcGIS to analyse GPS data transmitted via the GSM network and to vis- ually identify clusters of GPS locations, referred to as GPS location clusters (GLCs; Merrill et al., 2010). To reliably identify potential lynx kill and resting sites (Podgór- ski et al., 2008; Schmidt, 2008; Filla et al., 2017), a GLC was defined as a cluster where more than two GPS points were recorded within a 200-metre radius. Previous GPS telemetry studies on Eurasian lynx have shown that after killing an ungulate, lynx Spatial Dynamic and Ecology of A Male Eurasian Lynx, Lynx lynx (Carnivora, Felidae)... ISSN 2707-725X. Zoodiversity. 2025. Vol. 59, No. 4 333 frequently return to the kill site or remain within a 300-metre radius for more than one night (Breitenmoser & Breitenmoser-Würsten, 2008; Krofel et al., 2013; Melovski et al., 2020). When a GLC suggested a potential kill site, field investigations were carried out to locate prey remains. Starting from the center of the GLC, we used handheld GPS devices to search the surrounding area, expanding the search radius to 150 metres around each cluster location. In areas with dense vegetation, the search radius was extended as necessary. Environmental characteristics within a 50-metre radius of the kill site were recorded to capture all potentially relevant features. For resting sites, we aimed to identify the precise lynx bed site. If direct access was im- peded by impenetrable terrain, we recorded environmental characteristics at the nearest accessible location within a 150-meter radius, assuming it reliably represent- ed the actual bed site due to habitat homogeneity. The impact of human presence on lynx hunting and resting behaviour was as- sessed by analysing the proximity to the nearest rural settlements, as well as roads, using the “Near” tool in ArcGIS according to Melovski et al. (2020). The roads in the study area consisted solely of dirt roads and field and forest paths. The results are reported as the closest distances of lynx from rural settlements, as well as from roads. The study area lacked major settlements, urban centers, paved roads or highways. Consequently, these categories were excluded from the analysis as potential sources of disturbance. Results Lynx home range s ize We collected 487 fixes for the period between February 4, 2023 to August 6, 2023. From these data, we used all fixes for creating the annual home range, 257 fixes for summer home range and 230 fixes for winter home range. Furthermore, we utilised 143 fixes to define the breeding home range and 344 fixes for the non-breeding home range. On average, 70 fixes were used for the monthly home ranges (with the excep- tion of August, when only 14 fixes were available). The annual home range (MCP 95%) was 181.1 km² (Fig. 3; Table 1). In summer, the home range size (MCP 95%) was 172.1 km² (Fig. 4), while in winter, it decreased to 113.2 km² (Fig. 5; Table 1). The breeding season home range measured 129.2 km², whereas the non-breeding home range was larger at 181.6 km² (Table 1). All home range sizes were consistently larger when other estimators were applied, with MCP yielding smaller estimates compared to both KDE and AKDE (Tables 1, 2). KDE esti- mates were generally comparable to AKDE for annual, winter, and breeding home ranges, but were lower than AKDE during the summer and non-breeding seasons. Core areas (MCP 50%) comprised, on average, 26–31% of annual home ranges, 24– 30% of summer home ranges, and 23–24% of winter home ranges depending on the home range estimator (Figs 1–3; Table 1). The smallest core areas, representing 15– 20% of the home range, were observed during the breeding season, while the largest core areas, ranging from 25–34%, were recorded during the non-breeding season. Average monthly home range (MCP 95%) was 78.5 ± 15.6 km² (mean ± SE) depend- ing on the estimator used (Table 2). The smallest home range was 57.3 km² in February R. M. Cherepanyn, M. V. Franchuk, J. Kubala, Y. M. Andreychuk , T. S. Yamelynets et al. ISSN 2707-725X. Zoodiversity. 2025. Vol. 59, No. 4 334 (with the exception of August, when only 14 fixes were available), while the largest was 128 km² in June. The average monthly core area (MCP 50%) was 24.4 ± 8.3 km², with the small- est core area of 9.2 km² observed in May and the largest at 65.6 km² in July (Table 2). Predat ion and anthropogenic impact We identified 13 GPS location clusters (GLC) as potential kill sites, where we locat- ed remains from 21 kills (Fig. 6; Table 3), representing six species: roe deer (Capre- Fig. 3. GPS locations and the annual home range of a lynx in the study area are represented by Minimum Convex Polygons (MCPs) at 100% (green line), 95% (orange line), and 5% (red line) levels. The map also highlights human infrastructure within the study area Fig. 4. The summer home range of male lynx in the study area is depicted using GPS fixes and MCPs at the 100% (green line), 95% (orange line), and 50% (red line) levels. The map also high- lights human infrastructure within the study area Spatial Dynamic and Ecology of A Male Eurasian Lynx, Lynx lynx (Carnivora, Felidae)... ISSN 2707-725X. Zoodiversity. 2025. Vol. 59, No. 4 335 Table 1. Average annual and seasonal (summer and winter) home ranges (km2 ± SE) of male Eurasian lynx (Lynx lynx) in the study area using 95%, 100 and 50% Minimum convex polygon (MCP), Kernel density estimation (KDE) and Autocorrelated Kernel home range (AKDE) Home range method Annual Summer Winter Breeding Non-breeding HR mean 95%, km2 MCP 181.1 172.1 113.2 129.2 181.6 KDE 245.7 273.5 177.3 188.7 258.5 AKDE 255 321.6 175 179.2 297 HR mean 100%, km2 MCP 258.3 218.1 160.6 160.5 246.3 KDE 351.5 378.1 250.2 266.5 363 AKDE 339.2 467.5 236.8 265.4 367.7 HR mean 50%, km2 MCP 55.8 51.7 27.1 19.5 61.1 KDE 64.9 66.5 41.1 34.5 68.2 AKDE 66.8 79.1 42.2 35.6 75.6 Fig. 5. The winter home range of a lynx in the study area is depicted using GPS locations and Minimum Convex Polygons (MCPs) at 100% (green line), 95% (orange line), and 50% (red line) coverage levels. The map also highlights human infrastructure within the study area olus capreolus, n = 10), raccoon dog (Nyctereutes procyonoides, n = 5), brown hare (Lepus europaeus, n = 2), Eurasian beaver (Castor fiber, n = 1), wild boar (Sus scrofa, n = 1), red fox (Vulpes vulpes, n = 1), and hazel grouse (Tetrastes bonasia, n = 1). The lynx prey consisted predominantly of roe deer and brown hare. Additionally, there were instances where lynx killed raccoon dogs (n = 5) and a red fox (n = 1) but did not consume them, suggesting selective predation behaviour. Subcontinental moss R. M. Cherepanyn, M. V. Franchuk, J. Kubala, Y. M. Andreychuk , T. S. Yamelynets et al. ISSN 2707-725X. Zoodiversity. 2025. Vol. 59, No. 4 336 Scots pine forests, nemoral bog conifer woodlands, broadleaved swamp woodlands on acid peat, and non-riverine woodlands with Betula, Populus tremula, or Sorbus aucuparia dominate the habitats preferred by lynx for hunting. Furthermore, broadleaved swamp woodlands and nemoral bog conifer woodlands serve as the preferred resting sites. The average distance from kill sites to the nearest settlement was 4.53 ± 0.33 km (mean ± SE), while the average distance to the nearest road was 0.32 ± 0.05 km (Table 3). For roe deer, the average distance from kill sites to settlements was 4.12 ± 0.29 km, com- pared to 4.9 ± 0.29 km for other prey species. The difference in distances between roe deer and other prey species was not statistically significant. Moreover, the roe deer kill sites were located, on average, 0.43 ± 0.06 km from roads, compared to the 0.23 ± 0.07 km distance observed for other species. However, this difference was also not statistically significant. We also identified 8 GPS location clusters (GLC) as potential resting sites. The mean distance from resting sites to the closest settlement was 5.35 ± 0.31 km, where- as the average distance to the nearest road was 0.12 ± 0.03 km (Table 4). In summer, the mean distance from resting sites to settlements was 5.74 ± 0.39 km, decreasing to 4.9 ± 0.45 km in winter. Conversely, the average distance from resting sites to roads was 0.08 ± 0.04 km in summer, increasing to 0.18 ± 0.04 km in winter. Nonetheless, these seasonal differences did not reach statistical significance. Discussion The home range of a male lynx in the Rivnenskyi Nature Reserve was compara- ble to those observed in populations inhabiting similar environments, such as the Paazierre Forest in Belarus (Sidorovich, 2022) and the Białowieża Primeval Forest in Poland (Schmidt et al., 1997). This alignment in range size was also evident across mountainous regions of Central Europe, including the Bohemian Forest in Czechia, the Bavarian Forest in Germany, the Swiss Jura and North- Table 2. Mean monthly home range size (km2 ± SE) of male Eurasian lynx (Lynx lynx) in the study area using 95%, 100% and 50% Minimum convex polygon (MCP), Kernel density estimation (KDE) and Autocorrelated Kernel home range (AKDE) Home range method February March April May June July August HR mean 95%, km2 MCP 57.3 91.4 64.2 81 127.9 121 6.6 KDE 116.6 175.3 169.3 154.7 353.1 327.5 111.3 AKDE 116 155.7 269.2 174.7 519.7 479.4 502.7 HR mean 100%, km2 MCP 85.2 100.3 79.8 97.9 184.3 139.4 14.9 KDE 166.9 248.5 232.1 218.9 497.9 459.8 170.7 AKDE 172.1 228.6 399.4 262.3 766.5 712.5 177.5 HR mean 50%, km2 MCP 15 14.1 33.6 9.2 33.3 65.6 0.01 KDE 23.2 40.6 47.8 26.5 90 90.2 21.9 AKDE 26.1 35 67.6 36.6 129.3 122.6 113.7 Spatial Dynamic and Ecology of A Male Eurasian Lynx, Lynx lynx (Carnivora, Felidae)... ISSN 2707-725X. Zoodiversity. 2025. Vol. 59, No. 4 337 Fig. 6. The study area encompasses annual minimum convex polygons (MCPs) of an adult male lynx, calculated at 100% (green line), 95% (orange line), and 50% (red line) levels. GPS location clusters (GLCs) of potential kill sites (red polygons) and resting sites (green polygons) were docu- mented and verified through comprehensive field investigations. These clusters were then analysed in relation to their proximity to the nearest rural settlements, dirt roads, and field/forest paths Table 3. GPS location clusters (GLCs) identified for sites with remains from 21 kills, including the average distances to the nearest settlements and roads GLC ID Year Month Settlement distance, km Road distance, km Species H3 2023 2 4.9 0.07 Vulpes vulpes H2 2023 2 5.1 0.42 Capreolus capreolus H5 2023 2 3.9 0.68 Terastes bonasia H5 2023 2 3.9 0.68 Capreolus capreolus* H7 2023 2 4 0.2 Castor fiber H6 2023 2 5.4 0.66 Capreolus capreolus H1 2023 3 4.2 0.42 Capreolus capreolus H4 2023 3 4.1 0.18 Nyctereutes procyonoides H9 2023 3 4.3 0.39 Nyctereutes procyonoides* H10 2023 3 3.6 0.08 Capreolus capreolus H10 2023 3 3.6 0.08 Lepus europaeus H12 2023 3 3.2 0.4 Capreolus capreolus H2 2023 4 5 0.42 Sus scrofa H2 2023 4 5 0.42 Capreolus capreolus H3 2023 4 4.9 0.07 Lepus europaeus H12 2023 4 3.2 0.4 Capreolus capreolus H13 2023 4 3.5 0.4 Capreolus capreolus H8 2023 6 9.7 0.03 Nyctereutes procyonoides H11 2023 7 4.7 0.2 Nyctereutes procyonoides * Two individuals of Capreolus capreolus and Nyctereutes procyonoides species were killed in each GPS location clusters. R. M. Cherepanyn, M. V. Franchuk, J. Kubala, Y. M. Andreychuk , T. S. Yamelynets et al. ISSN 2707-725X. Zoodiversity. 2025. Vol. 59, No. 4 338 western Switzerland (Ryser et al., 2004; Breitenmoser-Würsten et al., 2007), and the Carpathians (Okarma et al., 2000, 2007). Eurasian lynx show significant var- iation in home range sizes across Europe. The smallest average ranges were re- corded in Switzerland’s northwestern Alps, while the largest were along north- ern Norway (Kubala et al., 2024). The MCP method consistently produced smaller home range estimates compared to KDE and AKDE, a pattern also doc- umented in previous studies (e. g., Schmidt et al., 1997; Melovski et al., 2020; Kubala et al., 2024). KDE and AKDE consider both spatial and temporal auto- correlation of locations, which often results in larger home range estimates. In contrast, MCP treats all location points equally, ignoring both their spatial dis- tribution and the sequence in which they were recorded. Lynx maintained a relatively stable home range size across seasons, consistent with findings from studies conducted in Norway (Walton et al., 2017), Poland (Schmidt et al., 1997; Jędrzejewski et al., 2002), Sweden (Danell et al., 2006), Swit- zerland (Breitenmoser & Breitenmoser-Würsten, 2008) and Western Carpathians (Kubala et al., 2024). However, summer home ranges were larger than those ob- served during winter (Tables  1, 2), in contrast to the seasonal estimates from Białowieża and the Western Carpathians (Schmidt et al., 1997; Schmidt, 2008; Ku- bala et al., 2024). This is indicating that male lynx do not generally adopt a roaming mating tactic (Sandell, 1989). Male lynx likely maintained larger, exclusive home ranges during the summer to minimise the presence of competing males ahead of the mating season. In winter, they used smaller areas with increased interaction, staying closer to receptive females (Breitenmoser et al., 1993; Schmidt et al., 1997; Herfindal et al., 2005). This pattern aligns with Sandell’s (1989) prediction that male home range size generally correlates with prey density but may shift in re- Table 4. Identified GPS location clusters (GLCs) for resting sites, detailing the average distances to the nearest settlements and roads GLC ID Year Month Settlement distance, km Road distance, km R2 2023 2 4.2 0.23 R4 2023 3 3.5 0.22 R6 2023 3 6 0.25 R2 2023 3 4.2 0.23 R1 2023 4 6.1 0.17 R3 2023 4 5.5 0.2 R4 2023 5 3.5 0.22 R7 2023 5 6.3 0.04 R8 2023 6 5.8 0.22 R6 2023 6 6 0.003 R7 2023 6 6.3 0.04 R5 2023 7 6.3 0.001 R6 2023 8 6 0.003 Spatial Dynamic and Ecology of A Male Eurasian Lynx, Lynx lynx (Carnivora, Felidae)... ISSN 2707-725X. Zoodiversity. 2025. Vol. 59, No. 4 339 sponse to changes in mating strategies. However, the small sample size limits the scope of our research to some extent, and additional data on more lynx, particular- ly females, are needed to draw more definitive conclusions about the intrinsic and environmental factors influencing home range size. Regarding predation, lynx in the Rivnenskyi Nature Reserve appear to have a similar ecological role to those in other parts of Central Europe, serving as apex predators of wild ungulates, particularly roe deer (Jędrzejewski et al., 1993; Molinari-Jobin et al., 2007; Andrén & Liberg, 2024). Predation data from 2023 indicate that male lynx in the study area killed 10 roe deer, representing 0.66% of the total hunting bag for the Rivne Region in 2021. As in other populations, its predation is not limited to ungulates and diet is supplemented by other spe- cies of smaller prey, including lagomorphs and small carnivores (Breitenmoser & Breitenmoser-Würsten, 2008; Melovski et al., 2020). This dietary pattern closely resembles that of lynx in the Paazierre Forest and the Naliboki Forest, Belarus (Sidorovich, 2022). Our study documented lynx abandoning red fox and common raccoon dog carcasses, with at least five instances involving rac- coon dogs along forest roads, contributing to the natural regulation of these trophic competitors within the ecosystem. An intriguing question arises re- garding the role of beavers in the lynx’s diet, particularly given their high den- sity in suitable habitats within the study area. However, further research is needed to confirm these findings and provide a more comprehensive under- standing of lynx predation ecology in this region and its habitats, as well as its implications for ungulate hunting management. Field examination of both kill and resting GLCs revealed that these areas predominantly consist of wet or heavily saturated biotopes with dense vegeta- tion, including lowland and transitional swamps. These habitats primarily in- clude swampy alder forests and pine forests along large marshes and within degraded drainage systems. In central Europe, lynx preferred open habitats such as meadows with abundant ungulates at night, while during the day, they selected dense, rugged areas away from human activity. Habitat selection was influenced by land cover in summer and by lower altitudes in winter (Filla et al., 2017; Belotti et al., 2018). Lynx preferentially select rugged terrain near rock formations, which provide shelter from temperature extremes, reduce encounters with humans, and enhance scent-marking effectiveness due to prominent locations (Signer et al., 2019; Hočervar et al., 2021). However, the Rivnenskyi Nature Reserve is characterised exclusively by flat terrain, lac’ing rugged landscapes or rocky formations. Consequently, our findings align with those reported in Poland’s Białowieża Lowland Forest and Belarus’s Paazierre Forest, where lynx preferentially selected kill and resting sites distinguished by complex, hard-to-access terrain, dense vegetation, and low visibility (Jędrzejewski et al., 1993; Schmidt, 2008; Sidorovich, 2022). The male lynx frequently visited hunters’ feeding sites, key locations for locating its primary prey, and often concealed its kills by dragging them several dozen metres into areas with dense undergrowth or trees, reducing visibility and minimising the risk of scavengers or predators stealing the carcass (Okarma et al., 1997; Podgórski et al., 2008). Lynx are highly selective in choosing resting sites, R. M. Cherepanyn, M. V. Franchuk, J. Kubala, Y. M. Andreychuk , T. S. Yamelynets et al. ISSN 2707-725X. Zoodiversity. 2025. Vol. 59, No. 4 340 with low visibility being a key factor, primarily resulting from dense trees and abundant undergrowth. Similar preferences have been observed in other lynx species, including the Iberian lynx (Lynx pardinus; Garrote et al., 2020), Can- ada lynx (Lynx canadensis; Mowat & Slogth, 2003), and bobcat (Lynx rufus; Morin et al., 2020), emphasising the importance of habitat cover for their conservation and management. Spatial dynamics, seasonal home ranges and monthly lynx movements, in- cluding distances from kill and resting sites to the nearest settlements and roads, in the Rivnenskyi Nature Reserve may be most likely influenced by the seasonal accessibility of certain areas. Lynx maintained an average distance of 4.5 km from kill sites to settlements and 320 m from roads. Resting sites were, on aver- age, located 5.35 km from settlements and 120 m from roads, with distances decreasing from summer to winter. In comparison, the average distance from kill sites to rural settlements in Mavrovo National Park, Macedonia, was much shorter, approximately 1.77 km (Melovski et al., 2020). In Norway, lynx also maintain shorter distances of 200 m from houses and roads (Sunde et al., 1998), whereas in the Bohemian Forest, they avoid human infrastructure, staying at least 1 km from settlements and 300 m from trails (Belotti et al., 2012; Filla et al., 2017). Similarly, bobcats typically avoid areas within 1 km of anthropogenic zones and 0.8–3 km of roads (Jones et al., 2022). Our findings support previous research showing that lynx exhibit seasonal habitat preferences and avoid areas with high human activity (Ripari et al., 2022; Oeser et al., 2023). To sustain their food supply, lynx must continuously track their primary prey. A significant por- tion of our male lynx home ranges overlaps with the challenging landscape of lowland swamps in the Lva River floodplain, fragmented by artificial embank- ments, dams, and roads along drainage canals. Our observations show that lynx frequently use forest roads, embankments, dams, and beaver dens for move- ment. From June to October, local residents gather wild berries, such as blueber- ries and cranberries, which increases human presence in forest and wetland are- as. Based on this, we hypothesize that seasonal human activity may interfere with the behaviour of both prey and lynx, potentially reshaping their spatial pat- terns and hunting strategies. To avoid disturbed areas, both predators and prey may seek refuge in more secluded habitats, such as waterlogged alder, birch, and mixed pine forests (Schmidt, 2008; Belotti et al., 2018). Nevertheless, a more in- depth investigation is necessary to fully understand the underlying factors and dynamics of this spatial behaviour. Overall, only 30.5% of recorded male lynx locations occurred within pro- tected areas, with 15.3% in the Rivnenskyi Nature Reserve and 15.2% in the Ve- lykoozerianskyi Botanical Reserve. The majority, 69.5%, were located in unpro- tected landscapes, including managed forestry zones, degraded marshlands, and active hunting grounds. Understanding the spatial dynamics and habitat needs of lynx is essential for effective conservation. Research in Scandinavia, for exam- ple, has shown that the extent of protected areas alone is often insufficient to sustain the entire lynx population (Linnell et al., 2001; 2021). A significant por- tion of lynx population occupy multiuse semi-natural areas where economic ac- tivities like logging, hunting, and agriculture are common von Arx, 2020; Spatial Dynamic and Ecology of A Male Eurasian Lynx, Lynx lynx (Carnivora, Felidae)... ISSN 2707-725X. Zoodiversity. 2025. Vol. 59, No. 4 341 Kaczensky et al., 2024). These semi-natural areas, while lacking strict protec- tions, are critical for lynx populations but require management strategies that balance conservation with human activities (Breitenmoser & Breitenmos- er-Würsten, 2008; Belotti et al., 2018; Linnell et al., 2021). Therefore, maintain- ing suitable conditions in hunting grounds, ensuring an adequate prey base in forestry and hunting areas, and involving not only conservation organisations but also forestry and hunting institutions in lynx monitoring, conservation and management efforts are essential for sustaining a viable lynx population state in the region. Conclusions Using GPS telemetry, we provide the first reliable estimates of home-range size, along with insights into the predation and resting ecology of lynx in the Rivnenskyi Nature Reserve and the adjacent lands in Ukraine. Our findings show that the ecological patterns closely resemble those of other European populations, particularly in the Paazierre Forest, Belarus, the Białowieża Pri- meval Forest, Poland. Lynx inhabit a home range of several hundred square kilometers, primarily feeding on wild ungulates. However, an important addi- tional factor is their occasional reliance on small prey and carnivores, a behav- iour that warrants further investigation. Our study suggests that lynx select resting sites with structural cover for concealment within the flat, swampy, and forested habitats, providing new insights into the ecological role of lynx in Ukraine and Eastern Europe. Nevertheless, the influence of intrinsic and eco- logical factors on lynx spatial dynamics and ecology requires additional and broader research. This underscores the need for more precise data and the es- tablishment of a standardised monitoring system based on spatial concepts, scientifically robust methods, and range-wide collaborative efforts (Kubala et al., 2021, 2023). Tackling these challenges with an efficient and adaptive ap- proach is crucial for gaining a clearer understanding of lynx ecology and the threats the species faces in this region. This will enable the development of relevant, specific, and targeted strategies and actions necessary for lynx con- servation in Ukraine, ensuring the long-term survival and sustainability of both the Baltic and Carpathian populations. Acknowledgements. All the work was supported, funded and coordinated by WWF-Ukraine via Coexistence for Conservation project (Funded by WWF-Poland); Nature FIRST project co-funded by the European Commission, HORIZON Research and Innovation Actions (Grant agreement ID 101060954 “Nature FIRST”); Supporting the coexistence and conservation of Carpathian LargE CArnivores — funded by the Interreg Central Europe, co-funded by the European Union (Grant agreement ID CE0100170 “LECA”); EuroLargeCarni- vores project — funded by the European LIFE Programme (LIFE16 GIE/ DE/000661). The lynx monitoring study is part of the WWF-Ukraine large car- nivore programme, and reflects the Lynx Single Species Action Plan under the Ministry of Environmental Protection and Natural Resources of Ukraine and R. M. Cherepanyn, M. V. Franchuk, J. Kubala, Y. M. Andreychuk , T. S. Yamelynets et al. ISSN 2707-725X. Zoodiversity. 2025. Vol. 59, No. 4 342 International Action Plan on Conservation of Large Carnivores and Ensuring Ecological Connectivity in the Carpathians in the frame of the Carpathian Con- vention. We are grateful to the administration of the Nature Reserve “Rivnen- skyi” for facilitating field work, as well as to the following colleagues for their help in the direct implementation of telemetry research: veterinarian Mykola Kychan and assistant Vovchenko Dmytro — for medical support and anaesthe- sia of the lynx, Oleksandr Dobrynskyi — for manufacturing equipment for telemetry research and assistance in animal catching, for technical support at all stages of the work (Taras Kryvulskyi, head of the Karasyn department of Nature Reserve “Rivnenskyi” — Kovalets Adam, inspectors (rangers) of the Nature Re- serve “Rivnenskyi” — Petro Martyniuk, Serhiy Shchevych, Mykhailo Tymoshyt- skyi, Oleksandr Kovalets). We are also grateful to the Ukrainian defenders for making it possible for Ukrainian scientists to live and work in the conditions of Russian armed aggression against Ukraine. Credit authorship contribution statement Roman Cherepanyn: Conceptualization (equal), Supervision (lead), Project man- agement (lead), Methodology (equal), Investigation (equal), Formal analysis (equal), Resources (equal), Visualisation (equal), Writing — original draft (lead), Writing — review & editing (equal). Mykhailo Franchuk: Conceptualization (equal), Methodology (equal), Investi- gation (lead), Formal analysis (equal), Resources (equal), Visualisation (equal), Writing — original draft (equal), Writing — review & editing (equal). Jakub Kubala: Conceptualization (equal), Methodology (equal), Formal analysis (equal), Visualisation (equal), Writing — original draft (equal), Writing – review & editing (equal). Yuriy Andreychuk: Conceptualization (equal), Methodology (equal), Investi- gation (equal), Formal analysis (equal), Spatial amalysis (equal), Resources (equal), Visualisation (lead), Writing — original draft (equal), Writing — review & editing (equal). Taras Yamelynets: Methodology (equal), Resources (equal), Writing — original draft (equal), Writing — review & editing (equal). Johannes Signer: Methodology (equal), Formal analysis (equal), Spatial analysis (equal), Resources (equal). Bohdan Vykhor: Conceptualization (equal), Methodology (equal), Resources (lead), Writing — review & editing (equal). Іhor Dykyy: Methodology (equal), Investigation (equal), Resources (equal), Writing — original draft (equal), Writing — review & editing (equal). Conflict of interest. The authors declare no conflict of interest. REFERENCES Akimov, I. A. 2009. Red Data Book of Ukraine. Animal world. Globalconsulting, Kyiv [In Ukrainian]. Action Plan for the Conservation of the Eurasian lynx (Lynx lynx L.) in Ukraine. Order of the Ministry of Environmental Protection and Natural Resources of Ukraine No 595 of 16 September 2021. Spatial Dynamic and Ecology of A Male Eurasian Lynx, Lynx lynx (Carnivora, Felidae)... ISSN 2707-725X. Zoodiversity. 2025. Vol. 59, No. 4 343 Andreichuk, Y. M. & Yamelynets, T. S. 2015. GIS in environmental research and nature con- servation. Prostir-М, Lviv [In Ukrainian]. Andrén, H. & Liberg, O. 2024. Numerical response of predator to prey: Dynamic interactions and population cycles in Eurasian lynx and roe deer. Ecological Monographs, 94 (1), e1594. https://doi.org/10.1002/ecm.1594 Belotti, E., Heurich, M., Kreisinger, J., Šustr, P. & Bufka, L. 2012. Influence of tourism and traffic on the Eurasian lynx hunting activity and daily movements. Animal Biodiversity and Conservation, 35 (2), 235–246. https://doi.org/10.32800/abc.2012.35.0235 Belotti, E., Mayer, K., Kreisinger, J., Heurich, M. & Bufka, L. 2018. Recreational activities affect resting site selection and foraging time of Eurasian lynx (Lynx lynx). Hystrix, 29 (2), 181. https://doi.org/10.4404/hystrix-00053-2018 Boitani, L. & Powell, R. A., eds. 2012. Carnivore ecology and conservation: a handbook of techniques. Techniques in Ecology & Conservation Series. Oxford University Press. https://doi.org/10.1093/acprof:oso/9780199558520.001.0001 Breitenmoser, U. & Breitenmoser-Würsten, C. 2008. Der Luchs. Ein Grossraubtier in der Kulturlandschaft. Salm Verlag, Wohlen/Bern, Switzerland. Breitenmoser, U., Kavczensky, P., Dötterer, M., Breitenmoser‐Würsten, C., Capt, S., Bernhart, F. & Liberek, M. 1993. Spatial organization and recruitment of lynx (Lynx lynx) in a reintroduced population in the Swiss Jura Mountains. Journal of Zoology, 231 (3), 449–464. https://doi.org/10.1111/j.1469-7998.1993.tb01931.x Breitenmoser, U., Breitenmoser-Würsten, C., Lanz, T., von Arx, M., Antonevich, A., Bao, W. & Avgan, B. 2015. Lynx lynx (errata version published in 2017). The IUCN Red List of Threatened Species 2015: e.T12519A121707666. Accessed on 20 November 2024. Breitenmoser‐Würsten, C., Zimmermann, F., Molinari‐Jobin, A., Molinari, P., Capt, S., Vandel, J. M., Stahl, P. & Breitenmoser, U. 2007. Spatial and social stability of a Eurasian lynx Lynx lynx population: an assessment of 10 years of observation in the Jura Mountains. Wildlife Biology, 13 (4), 365–380. https://doi.org/10.2981/0909-6396 (2007)13[365:SASSOA]2.0.CO;2 Calabrese, J. M., Fleming, C. H. & Gurarie, E. 2016. ctmm: an R package for analyzing animal relocation dataas a continuous-time stochastic process. Methods in Ecology and Evolution, 7, 1124–1132. https://doi.org/10.1111/2041-210X.12559 Chaskovskyy, O., Andreichuk, Y. & Yamelynets, T. 2021. The use of GIS in nature conserva- tion on the example of the open program QGIS. Prostir-M, Lviv [In Ukrainian]. Cherepanyn, R. M., Vykhor, B. I., Biatov, A. P., Yamelynets, T. S. & Dykyy, І. V. 2023 a. Population dynamics and spatial distribution of large carnivores in the Ukrainian Carpathians and Polissya. Biosystems Diversity, 31 (1), 10–19. https://doi. org/10.15421/012302 Cherepanyn, R., Vykhor, B., Yamelynets, T. & Dykyy, I. 2023 b. Number and Distribution of the Eurasian Lynx in Ukraine According to the Official Data. Quo Vadis Lynx? In- ternational Conference on Chances and Challenges in the Conservation of a Large Pred- ators in Europe — Expert Workshop on the Conservation of the Carpathian Lynx in West and Central Europe, Germany, Harz Mountains, Wöltingerode, 37–38. https:// doi.org/10.5281/zenodo.8132817 Cherepanyn, R., Vykhor, B. & Yamelynets, T. 2023 c. Large carnivore monitoring and hu- man-wildlife conflicts prevention in the Ukrainian Carpathians. Carpathian Future — Critical transition. International 7th Forum Carpaticum. Poland, Krakow, 160–161. https://doi.org/10.5281/zenodo.8406207 Cherepanyn, R. M., Zelenchuk, Y. I., Yamelynets, T. S., Vykhor, B. I. & Andreychuk, Y. M. 2024. Large carnivores and farmers/beekeepers conflicts in the Ukrainian Carpathians: structure, dynamics, spatial distribution and effective coexistence measures. Biosystems Diversity, 32 (3), 324–333. https://doi.org/10.15421/012435 R. M. Cherepanyn, M. V. Franchuk, J. Kubala, Y. M. Andreychuk , T. S. Yamelynets et al. ISSN 2707-725X. Zoodiversity. 2025. Vol. 59, No. 4 344 Danell, A. C., Andrén, H., Segerström, P. & Franzén, R. 2006. Space use by Eurasian lynx in relation to reindeer migration. Canadian Journal of Zoology, 84 (4), 546– 555. https://doi.org/10.1139/z06–021 Filla, M., Premier, J., Magg, N., Dupke, C., Khorozyan, I., Waltert, M., Bufka, L. & Heurich, M. 2017. Habitat selection by Eurasian lynx (Lynx lynx) is primarily driven by avoidance of human activity during day and prey availability during night. Ecol- ogy and Evolution, 7 (16), 6367–6381. https://doi.org/10.1002/ece3.3204 Fleming, C. H., Fagan, W. F., Mueller, T., Olson, K. A., Leimgruber, P. & Calabrese, J. M. 2015. Rigorous home range estimation with movement data: a new autocorrelated kernel density estimator. Ecology, 96 (5), 1182–1188. https://doi.org/10.1890/ 14-2010.1 Garrote, G., Fernández-López, J., Rojas, E., López, G. & Simón, M. A. 2020. Planning the peninsula-wide recovery of the Iberian lynx: Identification of favourable habitat areas. Mammalia, 84 (5), 413–420. https://doi.org/10.1515/mammalia-2019-0052 Gittleman, J. L. & Harvey, P. H. 1982. Carnivore home-range size, metabolic needs and ecology. Behavioral Ecology and Sociobiology, 10, 57–63. https://doi.org/10.1007/ BF00296396 Gittleman, J. L. 2013. Carnivore behaviour, ecology, and evolution. Springer Science & Business Media. Herfindal, I., C. Linnell, J. D., Odden, J., Nilsen, E. B. & Andersen, R. 2005. Prey density, environmental productivity and home-range size in the Eurasian lynx (Lynx lynx). Journal of Zoology, 265 (1), 63–71. https://doi.org/10.1017/S0952836904006053 Hočevar, L., Oliveira, T. & Krofel, M. 2021. Felid bedrooms with a panoramic view: selection of resting sites by Eurasian lynx (Lynx lynx) in a karstic landscape. Behav Ecol Sociobiol, 75, 34. https://doi.org/10.1007/s00265-021-02977-7 Jędrzejewski, W., Schmidt, K., Miłkowski, L., Jędrzejewska, B. & Okarma, H. 1993. Foraging by lynx and its role in ungulate mortality: the local (Białowieża Forest) and the Palaearctic viewpoints. Acta theriologica, 38 (4), 385-403. Jędrzejewski, W., Jędrzejewska, B., Okarma, H., Schmidt, K., Bunevich, A. N. & Milkowski, L. 1996. Population dynamics (1869–1994), demography, and home ranges of the lynx in Bialowieza Primeval Forest (Poland and Belarus). Ecography, 19 (2), 122–138. https://doi.org/10.1111/j.1600-0587.1996.tb00163.x Jędrzejewski, W., Schmidt, K., Okarma, H. & Kowalczyk, R. 2002. Movement pattern and home range use by the Eurasian lynx in Białowieża Primeval Forest (Poland). Annales Zoologici Fennici, 39 (1), 29–41. Jones, L. R., Johnson, S. A., Hudson, C. M., Zollner, P. A. & Swihart, R. K. 2022. Hab- itat selection in a recovering bobcat (Lynx rufus) population. PLOS ONE, 17 (8), e0269258. https://doi.org/10.1371/journal.pone.0269258 Kolowski, J. M. & Woolf, A. 2002. Microhabitat use by bobcats in southern Illinois. The Journal of Wildlife Management, 66 (3), 822–832. https://doi.org/10.2307/3803146 Kaczensky, P., Ranc, N., Hatlauf, J., Payne, J. C. et al. 2024. Large carnivore distribution maps and population updates 2017 2022/23. Report to the European Commission under contract N° 09.0201/2023/907799/SER/ENV.D.3 “Support for Coexistence with Large Carnivores”, “B.4 Update of the distribution maps”. IUCN/SSC Large Carnivore Initiative for Europe (LCIE) and Istituto di Ecologia Applicata (IEA). Krofel, M., Skrbinšek, T. & Kos, I. 2013. Use of GPS location clusters analysis to study predation, feeding, and maternal behavior of the Eurasian lynx. Ecological research, 28, 103–116. https://doi.org/10.1007/s11284-012-1005-x Kubala, J., Ćirović, D., Duľa, M., Kutal, M., Mysłajek, R. W., Nowak, S., Pop, M., Shkvyria, M., Sin, T., Szemethy, L., Tám, B. & Zlatanova, D. 2021. Conservation needs of the Carpathian lynx population. CATnews, 14, 12–15. Spatial Dynamic and Ecology of A Male Eurasian Lynx, Lynx lynx (Carnivora, Felidae)... ISSN 2707-725X. Zoodiversity. 2025. Vol. 59, No. 4 345 Kubala, J., Ćirović, D., Duľa, M., Dykyy, I., Figura, M., Gazzola, A., Gombkötő, P., Cherepanyn, R., Krojerová-Prokešová, J., Kutal, M., Mysłajek, R., Nowak, S., Pop, M., Sin, T., Smolko, P., Szemethy, L., Tám, B. & Zlatanova, D. 2023. The Status of the Lynx Population in the Carpathians. Quo Vadis Lynx? International Conference on Chances and Challenges in the Conservation of a Large Predator in Europe, Germany and the Harz Mountains, Wöltingerode May 10th 2023, 27–30. Kubala, J., Signer, J., Finďo, S., Duľa, M., Krojerová–Prokešová, J., Mysłajek, R.W., Nowak, S., Bučko, J., Skuban, M., Kutal, M., Bojda, M., Labuda, J., Figura, M., Barančeková, M., Homolka, M., Koubek, P., Slamka, M., Tám, B., Belák, M., Iľko, T., Machciník, B., Klinga, P., Sedliak, M., Kropil, R. & Smolko, P. 2024. Factors shaping home ranges of Eurasian lynx (Lynx lynx) in the Western Carpathians. Scientific reports, 14 (1), 21600. https://doi.org/10.1038/s41598-024-71800-w LifeLynx. 2018. Protocol for Eurasian lynx (Lynx lynx) capture, narcosis, transport, and quarantine in the Slovak Carpathians. https://www.lifelynx.eu/wp-content/ uploads/2018/06/C1_Protocol-for-lynx-capture-narcosis-transport-and-quarantine- in-the-Slovak-Carpathians.pdf (updated 2020). Linnell, J., Andersen, R., Kvam, T., Andrén, H., Liberg, O., Odden, J. & Moa P. F. 2001. Home Range Size and Choice of Management Strategy for Lynx in Scandinavia. Envi- ronmental Management, 27, 869–879. https://doi.org/10.1007/s002670010195 Linnell, J. D. C., Mattisson, J. & Oddén, J. 2021. Extreme home range sizes among eurasian lynx at the northern edge of their biogeographic range. Ecology and Evolution, 11 (10), 5001–5009. https://doi.org/10.1002/ece3.7436 List of animal species included in the Red Data Book of Ukraine (fauna). Order of the Minis- try of Environmental Protection and Natural Resources of Ukraine, January 19, 2021, No. 29. [Access from 12.03.2025: https://zakon.rada.gov.ua/laws/show/z0260-21#Text]. Marti, I. & Ryser-Degiorgis, M. P. 2018 a. A tooth wear scoring scheme for age estimation of the Eurasian lynx (Lynx lynx) under field conditions. European Journal of Wildlife Research, 64, 1–13. https://doi.org/10.1007/s10344-018-1198-6 Marti, I. & Ryser‐Degiorgis, M. P. 2018 b. Morphometric characteristics of free‐ranging Eurasian lynx Lynx lynx in Switzerland and their suitability for age estimation. Wildlife Biology, 1, 1–10. https://doi.org/10.2981/wlb.00432 Marynych, O. M. 1993. Polissia. Geographical encyclopedia of Ukraine: in 3 volumes. M. P. Bazhan “Ukrainian Soviet Encyclopedia”, Kyiv, Ukraine [In Ukrainian]. Marynych, O. M., Parkhomenko, H. O., Pashchenko, V. M., Petrenko, O. M. & Tyshchenko, P. H. 2007. National atlas of Ukraine. State Scientific Production Enterprise”Cartography”, Kyiv, Ukraine [In Ukrainian]. Melovski, D., Ivanov, G., Stojanov, A., Avukatov, V., Gonev, A., Pavlov, A., Breitenmoser, U., von Arx, M., Filla, M., Krofel, M., Signer, J. & Balkenhol, N. 2020. First insight into the spatial and foraging ecology of the critically endangered Balkan lynx (Lynx lynx balcanicus, Buresh 1941). Hystrix, 31 (1), 00254-2019. https://doi.org/10.4404/ hystrix-00254-2019 Merrill, E., Sand, H., Zimmermann, B., McPhee, H., Webb, N., Hebblewhite, M., Wabakken, P. & Frair, J. L. 2010. Building a mechanistic understanding of predation with GPS-based movement data. Philosophical Transactions of the Royal Society B: Biological Sciences, 365 (1550), 2279–2288. https://doi.org/10.1098/rstb.2010.0077 Mohr, C. O. 1947. Table of equivalent populations of North American small mammals. The American Midland Naturalist, 37 (1), 223–249. Molinari‐Jobin, A., Zimmermann, F., Ryser, A., Breitenmoser‐Würsten, C., Capt, S., Breitenmoser, U., Molinari, P., Haller, H. & Eyholzer, R. 2007. Variation in diet, prey selectivity and home‐range size of Eurasian lynx Lynx lynx in Switzerland. Wildlife Biol- ogy, 13 (4), 393–405. https://doi.org/10.2981/0909-6396(2007)13[393:VIDPSA]2.0.CO;2 R. M. Cherepanyn, M. V. Franchuk, J. Kubala, Y. M. Andreychuk , T. S. Yamelynets et al. ISSN 2707-725X. Zoodiversity. 2025. Vol. 59, No. 4 346 Morin, S. J., Bowman, J., Marrotte, R. R. & Fortin, M. J. 2020. Fine‐scale habitat selection by sympatric Canada lynx and bobcat. Ecology and Evolution, 10 (17), 9396–9409. https:// doi.org/10.1002/ece3.6626 Mowat, G. & Slough, B. 2003. Habitat preference of Canada lynx through a cycle in snowshoe hare abundance. Canadian journal of zoology, 81 (10), 1736–1745. https:// doi.org/10.1139/z03-174 Nagl, D., Breitenmoser, U., Hackländer, K., Ryser, A., Zimmermann, F., Signer, S., Haller, H., Breitenmoser-Würsten, C. & Vogt, K. 2022. Long‐term changes in habitat selection and prey spectrum in a reintroduced Eurasian lynx (Lynx lynx) population in Switzerland. Ecology and Evolution, 12 (2), e8614. https://doi.org/10.1002/ece3.8614 Oeser, J., Heurich, M., Kramer-Schadt, S., Andrén, H., Bagrade, G., Belotti, E., Bufka, L., Breitenmoser-Würsten, C., Černe, R., Duľa, M., Fuxjäger, C., Gomerčić, T., Jędrzejewski, W., Kont, R., Koubek, P., Kowalczyk, R., Krofel, M., Krojerová- Prokešová, J., Kubala, J., … Kuemmerle, T. 2023. Prerequisites for coexistence: Human pressure and refuge habitat availability shape continental-scale habitat use patterns of a large carnivore. Landscape Ecology, 38 (7), 1713–1728. https://doi. org/10.1007/s10980-023-01645-7 Okarma, H., Jedrzejewski, W., Schmidt, K., Kowalczyk, R. & Jedrzejewska, B. 1997. Predation of Eurasian lynx on roe deer and red deer in Bialowieza Primeral Forest, Poland. Acta Theriologica, 42 (2), 203–224. Okarma, H., Dovhanych, Y., Findo, S., Ionescu, O., Koubek, P. & Szemethy, L. 2000. Status of carnivores in the Carpathian ecoregion. Report of the Carpathian Ecoregion Initia- tive, 1–37. Okarma, H., Śnieżko, S. & Śmietana, W. 2007. Home ranges of eurasian lynx Lynx lynx in the Polish Carpathian Mountains. Wildlife Biology, 13 (4), 481–487. https://doi.org/10. 2981/0909-6396(2007)13[481:HROELL]2.0.CO;2 Oliveira, T., Mattisson, J., Vogt, K., Linnell, J., Odden, J., Oeser, J., Premier, J., Rodríguez-Re- cio, M., Belotti, E., Bufka, L., Černe, R., Duľa, M., Fležar, U., Gonev, A., Herdtfelder, M., Heurich, M., Hočevar, L., Hvala, T., Iľko, T., … Krofel, M. 2024. Ecological and intrin- sic drivers of foraging parameters of Eurasian lynx at a continental scale. Journal of Animal Ecology, 94 (1), 154–167. https://doi.org/10.1111/1365-2656.14228 Palmero, S., Smith, A. F., Kudrenko, S., Gahbauer, M., Dachs, D., Weingarth-Dachs, K., Kashpei, I., Shamovich, D., Vyshnevskiy, D., Borsuk, O., Korepanova, K., Bashta, A.-T., Zhuravchak, R., Fenchuk, V. & Heurich, M. 2023 a. Shining a light on elusive lynx: Density estimation of three Eurasian lynx populations in Ukraine and Belarus. Ecology and Evolution, 13, e10688. https://doi.org/10.1002/ece3.10688 Palmero, S., Premier, J., Kramer‐Schadt, S., Monterroso, P. & Heurich, M. 2023 b. Sampling variables and their thresholds for the precise estimation of wild felid population density with camera traps and spatial capture–recapture methods. Mammal Review, 53 (4), 223–237. https://doi.org/10.1111/mam.12320 Percie du Sert, N., Hurst, V., Ahluwalia, A., Alam, S., Avey, M. T., Baker, M., Browne W. J., Clark, A., Cuthill, I. C., Dirnagl, U., Emerson, M., Garner, P., Holgate, S. T., Howells, D. W., Karp, N. A., Lazic, S. E., Lidster, K., MacCallum, C. J., Macleod, M., Pearl, E. J., Petersen, O. H., Rawle, F., Reynolds, P., Rooney, K., Sena, E. S., Silberberg, S. D., Steckler, T. & Würbel, H. 2020. The ARRIVE guidelines 2.0: Updated guidelines for reporting animal research. PLoS Biol, 18 (7), e3000410. https://doi.org/10.1371/journal.pbio.3000410 Pesenti, E. & Zimmermann, F. 2013. Density estimations of the Eurasian lynx (Lynx lynx) in the Swiss Alps. Journal of Mammalogy, 94 (1), 73–81. https://doi.org/10.1644/11-MAMM-A-322.1 Podgórski, T., Schmidt, K., Kowalczyk, R. & Gulczyńska, A. 2008. Microhabitat selection by Eurasian lynx and its implications for species conservation. Acta Theriologica, 53, 97–110. https://doi.org/10.1007/BF03194243 Spatial Dynamic and Ecology of A Male Eurasian Lynx, Lynx lynx (Carnivora, Felidae)... ISSN 2707-725X. Zoodiversity. 2025. Vol. 59, No. 4 347 R Core Team. R: A language and environment for statistical computing. https://www.R- project.org/ (R Foundation for Statistical Computing 2021). Ripari, L., Premier, J., Belotti, E., Bluhm, H., Breitenmoser-Würsten, C., Bufka, L., Červený, J., Drouet-Hoguet, N., Fuxjäger, C., Jędrzejewski, W., Kont, R., Koubek, P., Kowalczyk, R., Krofel, M., Krojerová-Prokešová, J., Molinari-Jobin, A., Okarma, H., Oliveira, T., Remm, J., … Heurich, M. 2022. Human disturbance is the most limiting factor driving habitat selection of a large carnivore throughout Continental Europe. Biological Con- servation, 266, 109446. https://doi.org/10.1016/j.biocon.2021.109446 Ryser, A., Vonwattenwyl, K., Ryser-Degiorgis, M. P., Willisch, C., Zimmermann, F. & Breitenmoser, U. 2004. Luchsumsiedlung Nordostschweiz 2001–2003: Schlussbericht Modul Luchs des Projektes LUNO. KORA Bericht no. 22. KORA, Muri, Switzerland. Sandell, M. 1989. The mating tactics and spacing patterns of solitary carnivores. In: Carni- vore behaviour, ecology, and evolution. Springer US, Boston, MA, 164–182 Schmidt, K. 2008. Behavioural and spatial adaptation of the Eurasian lynx to a decline in prey availability. Acta Theriologica, 53, 1–16. https://doi.org/10.1007/BF03194274 Schmidt, K., Jedrzejewski, W. & Okarma, H. 1997. Spatial organization and social relations in the Eurasian lynx population in Bialowieza Primeval Forest, Poland. Acta theriolog- ica, 42 (3), 289–312. Shcherbak, M. M. 1994. Red Data Book of Ukraine. Animal world. Ukrainian Encyclopedia, Kyiv [In Ukrainian]. Shkvyrya, M. 2005. Monitoring researches of large carnivore mammals in Ukrainian Polissya. Sci. Bull. Uzhgorod Univ. (Ser. Biol.), 17, 100–104 [In Ukrainian]. Sidorovich, V. 2022. Behaviour and ecology of the Eurasian lynx. A case of study in Naliboki Forest and Paazierre Forest, Belarus. Publishing house “Four Quarters”, Minsk. Signer, J., Filla, M., Schoneberg, S., Kneib, T., Bufka, L., Belotti, E. & Heurich, M. 2019. Rocks rock: the importance of rock formations as resting sites of the Eurasian lynx Lynx lynx. Wildlife Biology, 2019 (1), 1–5. https://doi.org/10.2981/wlb.00489 Signer, S., Ryser, A., Ryser-Degiorgis, M.-P., Marti, I., Pisano, S. R. R., Breitenmoser- Würsten, C., Vogt, K., Thiel, D., Nagl, D., Pewsner, M., Wehrle, M., Kubala, J., Tám, B., Belák, M., Krebühl, J., Idelberger, S., Breitenmoser, U. & Stauffer, C. 2021. Luchsum- siedlungen aus der Schweiz von 2016–2020 in den Pfälzerwald und in die Kalkalpen. KORA Bericht 100, 1–26. Sunde, P., Stener, S. Ø. & Kvam, T. 1998. Tolerance to humans of resting lynxes Lynx lynx in a hunted population. Wildlife biology, 4 (3), 177–183. https://doi.org/10.2981/wlb.1998.020 Sunde, P., Kvam, T., Moa, P., Negard, A. & Overskaug, K. 2000. Space use by Eurasian lynxes Lynx lynx in central Norway. Acta theriologica, 45 (4), 507–524. https://doi. org/10.4098/AT.arch.00-50 Sunquist, M. E. & Sunquist, F. C. 1989. Ecological constraints on predation by large felids. In: Carnivore behaviour, ecology, and evolution. Springer US, Boston, MA, 283–301. Sunquist, F. & Sunquist, M. 2020. The Wild Cat Book: Everything you ever wanted to know about cats. University of Chicago Press. von Arx, M. 2020. Lynx lynx (amended version of 2018 assessment). The IUCN Red List of Threatened Species, e.T12519A177350310. https://dx.doi.org/10.2305/IUCN.UK.2020- 3.RLTS.T12519A177350310.en Vykhor, B., Dykyy, I., Tymochko, S., Franchuk, M., Khojetskyy, P., Cherepanyn, R. & Yamelynets, T. 2022. Lynx, bear and wolf monitoring methods. WWF–Ukraine [In Ukrainian]. http://doi.org/10.5281/zenodo.7533788 Walton, Z., Mattisson, J., C. Linnell, J. D., Stien, A. & Odden, J. 2017. The cost of migra- tory prey: Seasonal changes in semi-domestic reindeer distribution influences breed- ing success of Eurasian lynx in northern Norway. Oikos, 126 (5), 642–650. https://doi. org/10.1111/oik.03374 R. M. Cherepanyn, M. V. Franchuk, J. Kubala, Y. M. Andreychuk , T. S. Yamelynets et al. ISSN 2707-725X. Zoodiversity. 2025. Vol. 59, No. 4 348 White, S., Briers, R. A., Bouyer, Y., Odden, J. & Linnell, J. D. C. 2015. Eurasian lynx natal den site and maternal home‐range selection in multi‐use landscapes of Norway. Journal of Zoology, 297 (2), 87–98. https://doi:10.1111/jzo.12260 Worton, B. J. 1989. Kernel methods for estimating the utilization distribution in home-range studies. Ecology, 70 (1), 164–168. https://doi.org/10.2307/1938423 Zhyla, S. 2012. Polissian population of Lynx lynx in Ukraine and action plan on its conservation. Proceedings of the Theriological School, 11, 98–112 [In Ukrainian]. Received 19 December 2024 Accepted 21 August 2025
id oai:ojs.akademperiodyka.org.ua:article-730
institution Zoodiversity
issn 2707-7268
keywords_txt_mv
language English
last_indexed 2026-08-21T01:01:56Z
publishDate 2025
publisher Publishing House "Akademperiodyka" of the National Academy of Sciences of Ukraine
record_format ojs
resource_txt_mv ojsakademperiodykaorgua/5a/425c9d1262d39b4bc359b52314e44d5a.pdf
spelling oai:ojs.akademperiodyka.org.ua:article-7302026-08-20T12:37:07Z Spatial Dynamic and Ecology of a Male Eurasian Lynx, Lynx lynx (Carnivora, Felidae), in Volyn Polissia, Ukraine: First GPS-GSM Telemetry Findings Cherepanyn, R. M Franchuk, M. V. Kubala, J. Andreychuk, Y. M. Yamelynets, T. S. Signer, J. Vykhor, B. I. Dykyy, I. V. Eurasian lynx home range MCP KDE AKDE Polissia Ukraine In landscapes affected by human activity, understanding the spatial dynamics, predation behaviour and habitat preferences of large carnivores is essential for developing effective conservation strategies. The Eurasian lynx (Lynx lynx) plays a vital role in maintaining the ecological balance of temperate and boreal forests in Europe and Asia. However, the ecological patterns and behavior of lynx populations in Ukraine remain poorly studied. This study, based on GPS telemetry data collected from February to August 2023 in the Rivnenskyi Nature Reserve and adjacent territories, is the first to provide a comprehensive assessment of lynx home range, predation ecology and habitat selection in Ukraine. The average annual home range size of the lynx ranged from 181 to 255 km², depending on the home range estimator used (95 % MCP, KDE, and AKDE), with significant seasonal variation: larger ranges in summer (172 km², 95 % MCP) compared to smaller winter ranges (113.2 km², 95 % MCP). The lynx primarily preyed on roe deer (Capreolus capreolus) and brown hare (Lepus europaeus), occasionally targeting smaller prey and carnivores, including the raccoon dog (Nyctereutes procyonoides). Kills and resting sites were located in dense, low-visibility areas such as swampy coniferous and deciduous forests. Moreover, the study demonstrated that lynx actively avoided human settlements and roads, particularly during summer, highlighting the influence of anthropogenic factors. While our findings align with patterns observed in other European lynx populations, they also reveal regional variations driven by local landscape features. Of the lynx telemetry observations, 30.5% occurred within protected areas and 69.5% in forestry enterprises, degraded marshlands and hunting grounds. These results emphasise the importance of spatial ecology in carnivore conservation and highlight the need for continued monitoring to assess the impact of human activity on lynx populations in Ukraine. Furthermore, this study provides valuable insights for developing targeted conservation strategies involving local communities and stakeholders for the species in Ukraine and Eastern Europe. It also emphasises the need for standardised monitoring to facilitate comparative analyses of lynx ecology across different regions, including the Baltic and the Carpathians. Publishing House "Akademperiodyka" of the National Academy of Sciences of Ukraine 2025-06-26 Article Article application/pdf https://ojs.akademperiodyka.org.ua/index.php/Zoodiversity/article/view/730 10.15407/zoo2025.04.327 Zoodiversity; Vol. 59 No. 4 (2025): Zoodiversity Zoodiversity (Vestnik Zoologii); Том 59 № 4 (2025): Zoodiversity 2707-7268 2707-725X 10.15407/zoo2025.04 en https://ojs.akademperiodyka.org.ua/index.php/Zoodiversity/article/view/730/331 Copyright (c) 2025 Roman Cherepanyn, Mykhailo Franchuk, Jakub Kubala, Yuriy Andreychuk, Taras Yamelynets, Johannes Signer, Bohdan Vykhor, Ihor Dykyy
spellingShingle Cherepanyn, R. M
Franchuk, M. V.
Kubala, J.
Andreychuk, Y. M.
Yamelynets, T. S.
Signer, J.
Vykhor, B. I.
Dykyy, I. V.
Spatial Dynamic and Ecology of a Male Eurasian Lynx, Lynx lynx (Carnivora, Felidae), in Volyn Polissia, Ukraine: First GPS-GSM Telemetry Findings
title Spatial Dynamic and Ecology of a Male Eurasian Lynx, Lynx lynx (Carnivora, Felidae), in Volyn Polissia, Ukraine: First GPS-GSM Telemetry Findings
title_full Spatial Dynamic and Ecology of a Male Eurasian Lynx, Lynx lynx (Carnivora, Felidae), in Volyn Polissia, Ukraine: First GPS-GSM Telemetry Findings
title_fullStr Spatial Dynamic and Ecology of a Male Eurasian Lynx, Lynx lynx (Carnivora, Felidae), in Volyn Polissia, Ukraine: First GPS-GSM Telemetry Findings
title_full_unstemmed Spatial Dynamic and Ecology of a Male Eurasian Lynx, Lynx lynx (Carnivora, Felidae), in Volyn Polissia, Ukraine: First GPS-GSM Telemetry Findings
title_short Spatial Dynamic and Ecology of a Male Eurasian Lynx, Lynx lynx (Carnivora, Felidae), in Volyn Polissia, Ukraine: First GPS-GSM Telemetry Findings
title_sort spatial dynamic and ecology of a male eurasian lynx, lynx lynx (carnivora, felidae), in volyn polissia, ukraine: first gps-gsm telemetry findings
topic_facet Eurasian lynx
home range
MCP
KDE
AKDE
Polissia
Ukraine
url https://ojs.akademperiodyka.org.ua/index.php/Zoodiversity/article/view/730
work_keys_str_mv AT cherepanynrm spatialdynamicandecologyofamaleeurasianlynxlynxlynxcarnivorafelidaeinvolynpolissiaukrainefirstgpsgsmtelemetryfindings
AT franchukmv spatialdynamicandecologyofamaleeurasianlynxlynxlynxcarnivorafelidaeinvolynpolissiaukrainefirstgpsgsmtelemetryfindings
AT kubalaj spatialdynamicandecologyofamaleeurasianlynxlynxlynxcarnivorafelidaeinvolynpolissiaukrainefirstgpsgsmtelemetryfindings
AT andreychukym spatialdynamicandecologyofamaleeurasianlynxlynxlynxcarnivorafelidaeinvolynpolissiaukrainefirstgpsgsmtelemetryfindings
AT yamelynetsts spatialdynamicandecologyofamaleeurasianlynxlynxlynxcarnivorafelidaeinvolynpolissiaukrainefirstgpsgsmtelemetryfindings
AT signerj spatialdynamicandecologyofamaleeurasianlynxlynxlynxcarnivorafelidaeinvolynpolissiaukrainefirstgpsgsmtelemetryfindings
AT vykhorbi spatialdynamicandecologyofamaleeurasianlynxlynxlynxcarnivorafelidaeinvolynpolissiaukrainefirstgpsgsmtelemetryfindings
AT dykyyiv spatialdynamicandecologyofamaleeurasianlynxlynxlynxcarnivorafelidaeinvolynpolissiaukrainefirstgpsgsmtelemetryfindings